Protein detail
CD79B
B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)
Protein symbol CD79B | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)
Protein Class
Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins
Protein Function
- Cancer-related genes:Mutated cancer genes
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Disease related genes
- FDA approved drug targets:Biotech drugs
Transmembrane
160..180; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
B29Ig-betaIGBIgbeta
Gene Description
CD79b molecule
Chromosome
17
Position
63928738-63932336
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Function & Pathway
Protein Function
- Cancer-related genes:Mutated cancer genes
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component
Molecular Function
Biological Process
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-5690714 cd22 mediated bcr regulation
- R-hsa-5663205 infectious disease
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9679506 sars cov infections
- R-hsa-983705 signaling by the b cell receptor bcr
- R-hsa-9824446 viral infection pathways
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
26 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD79B | LCK | P06239 | Y | 207 | phosphorylation | KEA | KEA:8077654KEA:9531288 |
| CD79B | LCK | P06239 | Y | 92 | phosphorylation | KEA | KEA:8077654KEA:9531288 |
| CD79B | BLK | P51451 | Y | 207 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79B | BLK | P51451 | Y | 196 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79B | SRMS | Q9H3Y6 | Y | 207 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD79B | SRMS | Q9H3Y6 | Y | 196 | phosphorylation | Reactome_ProtMapperProtMapper |
Page 3 of 3Previous
Ligand-Receptor Signaling
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LYN | P07948 | CD79B | P40259 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangNetworKIN_KEAHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperSPIKE_LCSPIKE | SPIKE_LC:12453414SPIKE:12453414KEA:8077654HPRD:9531288phosphoELM:9531288ProtMapper:9531288SIGNOR:9531288KEA:9531288KEA:17570479HPRD-phos:9531288 |
| FYN | P06241 | CD79B | P40259 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperHPRD-phos | KEA:8077654HPRD:9531288phosphoELM:9531288ProtMapper:9531288SIGNOR:9531288KEA:9531288HPRD-phos:9531288 |
| SH2B1 | Q9NRF2 | CD79B | P40259 | Yes | No | Yes | SIGNOR | SIGNOR:32323266 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
229
Mass
26,048
Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=Long; IsoId=P40259-1; Sequence=Displayed; Name=Short; IsoId=P40259-2; Sequence=VSP_002477; Name=3; IsoId=P40259-3; Sequence=VSP_047222
Alternative Sequence
23; A -> AA (in isoform 3); 41..144; Missing (in isoform Short)
3D Structural Models
Turn
93..95
Helix
114..116; 151..181
Beta Strand
46..49; 51..56; 60..66; 69..72; 74..79; 96..100; 105..111; 118..125; 127..129; 132..134; 138..140
3D Structure
Electron microscopy (4); X-ray crystallography (1)
Domain & Motif Annotations
Domain (CC)
The transmembrane helices of CD79A and CD79B chains and two IgM heavy chains assembly in a four-helix bundle structure that appears to be conserved among different BCR isotypes.
Domain (FT)
38..138; Ig-like V-type; 185..213; ITAM
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantFDA approved drug targets
Related Diseases
Biomarker
Phase 1; Approved; Phase 2
Drug Targets
FDA approved drug targets