Protein detail

CD79B

B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)

Protein symbol CD79B	UniProt ID P40259	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

B-cell antigen receptor complex-associated protein beta chain (B-cell-specific glycoprotein B29) (Ig-beta) (Immunoglobulin-associated B29 protein) (CD antigen CD79b)

Protein Class

Cancer-related genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins

Protein Function

Cancer-related genes:Mutated cancer genes
CD markers
Human disease related genes:Immune system diseases:Primary immunodeficiency
Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
Disease related genes
FDA approved drug targets:Biotech drugs

Transmembrane

160..180; Helical

Transmembrane Count

Ensembl

ENSG00000007312

Entrez Gene Symbol

CD79B

Gene Synonym

B29Ig-betaIGBIgbeta

Gene Description

CD79b molecule

Chromosome

Position

63928738-63932336

Frequency

EVMP Score

0.50

Fluorescence & Localization

Function & Pathway

Protein Function

Cancer-related genes:Mutated cancer genes
CD markers
Human disease related genes:Immune system diseases:Primary immunodeficiency
Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
Disease related genes
FDA approved drug targets:Biotech drugs

Cellular Component

Molecular Function

Biological Process

KEGG

hsa04662 B cell receptor signaling pathway

Reactome

Mediation Categories

Clinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence

Enzyme-Mediated Modification

26 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
CD79B	LYN	P07948	Y	197	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMP
CD79B	LYN	P07948	Y	208	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMP
CD79B	FER	P16591	Y	196	phosphorylation	Li2012
CD79B	FER	P16591	Y	207	phosphorylation	Li2012
CD79B	SRC	P12931	Y	196	phosphorylation	Li2012
CD79B	SRC	P12931	Y	207	phosphorylation	Li2012
CD79B	LCK	P06239	Y	197	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
CD79B	LCK	P06239	Y	208	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
CD79B	LCK	P06239	Y	103	phosphorylation	KEA	KEA:8077654 KEA:9531288
CD79B	LCK	P06239	Y	196	phosphorylation	KEA	KEA:8077654 KEA:9531288

Page 2 of 3Previous Next

Ligand-Receptor Signaling

29 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
receptor	receptor	scConnect	No	Yes	No	Yes	No
receptor	receptor	CellCellInteractions	No	Yes	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 3 of 3Previous

Regulatory Interaction Network

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LYN	P07948	CD79B	P40259	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangNetworKIN_KEAHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperSPIKE_LCSPIKE	SPIKE_LC:12453414 SPIKE:12453414 KEA:8077654 HPRD:9531288 phosphoELM:9531288 ProtMapper:9531288 SIGNOR:9531288 KEA:9531288 KEA:17570479 HPRD-phos:9531288
FYN	P06241	CD79B	P40259	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDWangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperReactome_ProtMapperHPRD-phos	KEA:8077654 HPRD:9531288 phosphoELM:9531288 ProtMapper:9531288 SIGNOR:9531288 KEA:9531288 HPRD-phos:9531288
SH2B1	Q9NRF2	CD79B	P40259	Yes	No	Yes	SIGNOR	SIGNOR:32323266

Protein Complex Composition

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CD79B	P40259	2	PDB	PDB:3kg5

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Protein Organic Solvent Precipitation	Mass spectrometry	1	32384937

Sequence, Structure & Domains

Sequences

Length

229

Mass

26,048

Sequence

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=Long; IsoId=P40259-1; Sequence=Displayed; Name=Short; IsoId=P40259-2; Sequence=VSP_002477; Name=3; IsoId=P40259-3; Sequence=VSP_047222

Alternative Sequence

23; A -> AA (in isoform 3); 41..144; Missing (in isoform Short)

3D Structural Models

Turn

93..95

Helix

114..116; 151..181

Beta Strand

46..49; 51..56; 60..66; 69..72; 74..79; 96..100; 105..111; 118..125; 127..129; 132..134; 138..140

3D Structure

Electron microscopy (4); X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

The transmembrane helices of CD79A and CD79B chains and two IgM heavy chains assembly in a four-helix bundle structure that appears to be conserved among different BCR isotypes.

Domain (FT)

38..138; Ig-like V-type; 185..213; ITAM

Clinical Relevance

Disease Involvement

Cancer-related genesDisease variantFDA approved drug targets

Related Diseases

Autoimmune disease Diffuse large B-cell lymphoma Follicular lymphoma Malignant haematopoietic neoplasm Mature B-cell lymphoma

Biomarker

Phase 1; Approved; Phase 2

Drug Targets

FDA approved drug targets

Drugs

POLATUZUMAB VEDOTIN MGD-010 DIOA

Antibody

HPA009178 CAB009751 HPA044107