Protein detail
CCR2
C-C chemokine receptor type 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (Monocyte chemoattractant protein 1 receptor) (MCP-1-R) (CD antigen CD192)
Entry name CCR2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count 7 | Protein classification CD markersG-protein coupled receptorsHuman disease related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
C-C chemokine receptor type 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (Monocyte chemoattractant protein 1 receptor) (MCP-1-R) (CD antigen CD192)
Protein Class (4)
CD markersG-protein coupled receptorsHuman disease related genesPredicted membrane proteins
Protein Function (4)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- CD markers
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
43..70; Helical; Name=1; 81..100; Helical; Name=2; 115..136; Helical; Name=3; 154..178; Helical; Name=4; 207..226; Helical; Name=5; 244..268; Helical; Name=6; 286..309; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
CC-CKR-2CD192CKR2CMKBR2FLJ78302MCP-1-R
Gene Description
C-C motif chemokine receptor 2
Chromosome
3
Position
46353864-46360940
Supporting publications (n)
3
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway7
Protein Function (4)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- CD markers
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (9)
Molecular Function (9)
- GO:0004950 chemokine receptor activity
- GO:0005515 protein binding
- GO:0016493 C-C chemokine receptor activity
- GO:0019957 C-C chemokine binding
- GO:0031727 CCR2 chemokine receptor binding
- GO:0035715 chemokine (C-C motif) ligand 2 binding
- GO:0035716 chemokine (C-C motif) ligand 12 binding
- GO:0035717 chemokine (C-C motif) ligand 7 binding
- GO:0042802 identical protein binding
Biological Process (3)
KEGG (3)
Reactome (13)
- R-hsa-6803157 antimicrobial peptides
- R-hsa-1461957 beta defensins
- R-hsa-380108 chemokine receptors bind chemokines
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-1461973 defensins
- R-hsa-500792 gpcr ligand binding
- R-hsa-418594 g alpha i signalling events
- R-hsa-168249 innate immune system
- R-hsa-6783783 interleukin 10 signaling
Page 1 of 2
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence67
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CCR2 | JAK2 | O60674 | Y | 139 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9670957KEA:9670957phosphoELM:9670957ProtMapper:9670957 |
Ligand-Receptor Signaling (61)
61 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | talklr | No | Yes | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
Protein Complex Composition (1)
Sequence, Structure & Domains12
Sequences
Length
374
Mass
41,915
Sequence
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=A; IsoId=P41597-1; Sequence=Displayed; Name=B; IsoId=P41597-2; Sequence=VSP_001893
Alternative Sequence
314..374; SLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA -> RYLSVFFRKHITKRFCKQCPVFYRETVDGVTSTNTPSTGEQEVSAGL (in isoform B)
3D Structural Models
Turn
72..74; 266..268; 296..300
Helix
38..69; 76..92; 95..103; 110..142; 146..151; 154..170; 173..177; 196..210; 212..228; 237..265; 269..272; 279..295; 301..308; 310..318
Beta Strand
179..184; 187..192
3D Structure
Electron microscopy (1); NMR spectroscopy (2); X-ray crystallography (2)
Domain & Motif Annotations
Region
348..374; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance5
Disease Involvement
Disease variant
Related Diseases (17)
Alzheimer diseaseArterial occlusive diseaseChronic kidney diseaseChronic obstructive pulmonary diseaseChronic painGeneral pain disorderHuman immunodeficiency virus diseaseInsulin-resistance syndromeMelanomaMetastatic tumourMultiple sclerosisPancreatic cancerPostoperative inflammationRetinopathyRheumatoid arthritisSolid tumour/cancerViral encephalitis
Biomarker
Investigative; Terminated; Phase 2; Phase 1; Discontinued in Phase 2
Drugs (23)
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 30301952 | A position on vision. | No abstract available |
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No abstract available |
| 40595564 | Enrichment of extracellular vesicles using Mag-Net for the analysis of the plasma proteome. | No abstract available |