Protein detail
TEC
Tyrosine-protein kinase Tec (EC 2.7.10.2)
Entry name TEC | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 9 | Transmembrane count | Protein classification EnzymesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Tyrosine-protein kinase Tec (EC 2.7.10.2)
Protein Class (3)
EnzymesPlasma proteinsPredicted intracellular proteins
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases:Tyr protein kinases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PSCTK4
Gene Description
Tec protein tyrosine kinase
Chromosome
4
Position
48135783-48269838
Supporting publications (n)
9
EVMP confidence score
0.38
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificCardiomyocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases:Tyr protein kinases
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (5)
Biological Process (3)
Reactome (8)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2871809 fceri mediated ca 2 mobilization
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-168249 innate immune system
- R-hsa-512988 interleukin 3 interleukin 5 and gm csf signaling
- R-hsa-449147 signaling by interleukins
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-1433557 signaling by scf kit
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence35
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TEC | BTK | Q06187 | Y | 206 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:12573241SIGNOR:12573241ProtMapper:12573241phosphoELM:12573241 |
| TEC | ITK | Q08881 | Y | 206 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:12573241SIGNOR:12573241ProtMapper:12573241phosphoELM:12573241 |
Ligand-Receptor Signaling (8)
8 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (9)
9 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TEC | P42680 | STAP1 | Q9ULZ2 | Yes | Yes | NetPathSIGNORPhosphoPointHPRDHINTSPIKE_LCSPIKE | SPIKE:10518561HPRD:10518561HINT:10518561NetPath:10518561HPRD:11716489SIGNOR:10518561SPIKE_LC:10518561HINT:11716489 | |
| STAP1 | Q9ULZ2 | TEC | P42680 | Yes | Yes | NetPathSIGNORHPRDHINTSPIKE_LCSPIKE | SPIKE:10518561HPRD:10518561HINT:10518561NetPath:10518561HPRD:11716489SIGNOR:10518561SPIKE_LC:10518561HINT:11716489 | |
| TEC | P42680 | PTN18 | Q99952 | Yes | SPIKEPhosphoSite_MIMPMIMPNetPathHPRD_MIMPPhosphoSite_norefPhosphoPointiPTMnetProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASPIKE_LCPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:14679216NetPath:14679216HPRD:14679216SPIKE_LC:14679216KEA:14679216HPRD:15588985PhosphoSite:23322602SPIKE:14679216ProtMapper:14679216PhosphoSite:19410646 | ||
| TEC | P42680 | BTK | Q06187 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAKinexus_KEAHPRD_KEASIGNOR_ProtMapperHPRD-phosPhosphoSite_ProtMapper | HPRD-phos:11598012KEA:11598012ProtMapper:8629002HPRD-phos:12573241ProtMapper:8630736ProtMapper:12445832KEA:8630736KEA:12573241HPRD:12445832HPRD:8629002ProtMapper:11598012ProtMapper:12573241HPRD:8630736SIGNOR:12573241KEA:12445832HPRD:12573241HPRD:11598012KEA:8629002HPRD-phos:8629002ProtMapper:16497976HPRD-phos:8630736HPRD-phos:16497976HPRD-phos:12445832 | |
| BTK | Q06187 | TEC | P42680 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAKinexus_KEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:12573241HPRD:8630736phosphoELM:12573241KEA:12573241SIGNOR:12573241HPRD:12445832HPRD:12573241HPRD:11598012HPRD:8629002 | |
| TEC | P42680 | MAF | O75444 | Yes | Yes | RLIMS-P_ProtMapperSIGNORProtMapper | ProtMapper:25993510SIGNOR:25993510 | |
| TEC | P42680 | BMX | P51813 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:12573241phosphoELM:12573241KEA:12573241SIGNOR:12573241HPRD:12573241 | |
| ITK | Q08881 | TEC | P42680 | Yes | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAKinexus_KEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | KEA:12573241SIGNOR:12573241ProtMapper:12573241phosphoELM:12573241 | |
| TEC | P42680 | FGF2 | P09038 | Yes | dbPTMiPTMnetPhosphoSite | PhosphoSite:27382052dbPTM:20230531 |
Protein Complex Composition (15)
15 records.
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
631
Mass
73,581
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR
3D Structural Models
Helix
56..58; 96..110
Beta Strand
3..14; 19..21; 26..41; 45..47; 53..55; 61..64; 69..71; 74..76; 78..83; 88..92; 118..120; 132..134; 143..145
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Zinc Finger
113..149; Btk-type
Domain (CC)
The PH domain mediates the binding to inositol polyphosphate and phosphoinositides, leading to its targeting to the plasma membrane. It is extended in the BTK kinase family by a region designated the TH (Tec homology) domain, which consists of about 80 residues preceding the SH3 domain.; DOMAIN: The SH3 domain is essential for its targeting to activated CD28 costimulatory molecule.
Domain (FT)
4..111; PH; 179..239; SH3; 247..345; SH2; 370..623; Protein kinase
Region
157..178; Disordered
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- TEC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
Clinical Relevance
Supporting Publications9
| PMID | Title | Related sentences |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 26775013 | Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers. | No related sentences available |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No related sentences available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38556629 | Differential effects of physiological agonists on the proteome of platelet-derived extracellular vesicles. | No related sentences available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No related sentences available |
| 40545963 | Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer. | No related sentences available |