Protein detail
EAA1
Excitatory amino acid transporter 1 (Sodium-dependent glutamate/aspartate transporter 1) (GLAST-1) (Solute carrier family 1 member 3)
Protein symbol EAA1 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 8 | Protein classification Cancer-related genesDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Excitatory amino acid transporter 1 (Sodium-dependent glutamate/aspartate transporter 1) (GLAST-1) (Solute carrier family 1 member 3)
Protein Class
Cancer-related genesDisease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
Transmembrane
48..68; Helical; Name=1; 87..108; Helical; Name=2; 123..145; Helical; Name=3; 237..260; Helical; Name=4; 270..297; Helical; Name=5; 319..340; Helical; Name=6; 386..412; Helical; Name=7; 473..494; Helical; Name=8
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
Gene Synonym
EA6EAAT1GLASTGLAST-1GLAST1
Gene Description
Solute carrier family 1 member 3
Chromosome
5
Position
36596588-36688334
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Tissue SpecificcervixCell SpecificCardiomyocytes
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
Cellular Component
Molecular Function
- GO:0005313 L-glutamate transmembrane transporter activity
- GO:0005314 high-affinity L-glutamate transmembrane transporter activity
- GO:0005515 protein binding
- GO:0015175 neutral L-amino acid transmembrane transporter activity
- GO:0015501 glutamate:sodium symporter activity
- GO:0016595 glutamate binding
- GO:0046872 metal ion binding
Biological Process
KEGG
Reactome
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-210500 glutamate neurotransmitter release cycle
- R-hsa-112316 neuronal system
- R-hsa-112310 neurotransmitter release cycle
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-9958863 slc mediated transport of amino acids
- R-hsa-5619102 slc transporter disorders
- R-hsa-112315 transmission across chemical synapses
- R-hsa-382551 transport of small molecules
Mediation Categories
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC1A3 | SGK1 | O00141 | T | 482 | phosphorylation | MIMPHPRD_MIMPKEASIGNOR | SIGNOR:12911626KEA:12911626 |
| SLC1A3 | CAMK2A | Q9UQM7 | T | 26 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SLC1A3 | CAMK2A | Q9UQM7 | T | 37 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper |
Ligand-Receptor Signaling
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| slc1 | transporter | Surfaceome | No | Yes | No | No | No |
| slc | transporter | Surfaceome | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SGK1 | O00141 | EAA1 | P43003 | Yes | Yes | No | MIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | SIGNOR:12911626HPRD:12911626KEA:12911626ProtMapper:12911626 |
| CAV1 | Q03135 | EAA1 | P43003 | Yes | No | Yes | SIGNOR | SIGNOR:26690923 |
| KCC2A | Q9UQM7 | EAA1 | P43003 | Yes | No | No | PhosphoSite_norefPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:27889915 |
Protein Complex Composition
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Glutamate_byGLS2_and_SLC1A3 | GLS2SLC1A3 | P43003Q9UI32 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:Glutamate_byGLS2_and_SLC1A3 | |
| Glutamate_byGLS_and_SLC1A3 | GLSSLC1A3 | O94925P43003 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:Glutamate_byGLS_and_SLC1A3 | |
| KCTD17KCTD2KCTD5PDPK1SLC1A3TMEM45A | O15530P43003Q14681Q8N5Z5Q9NWC5Q9NXV2 | 0:0:0:0:0:0 | hu.MAP2 | |||
| KCTD2KCTD5PDPK1POLKSLC1A3TMEM45A | O15530P43003Q14681Q9NWC5Q9NXV2Q9UBT6 | 0:0:0:0:0:0 | hu.MAP | |||
| KCTD5PDPK1SLC1A3TMEM45A | O15530P43003Q9NWC5Q9NXV2 | 0:0:0:0 | hu.MAP | |||
| SLC1A3 | P43003 | 3 | PDB | PDB:7npw | ||
| KCTD17KCTD2KCTD5POLKSLC1A3TMEM45A | P43003Q14681Q8N5Z5Q9NWC5Q9NXV2Q9UBT6 | 0:0:0:0:0:0 | hu.MAP2 | |||
| KCTD2KCTD5SLC1A3TMEM45A | P43003Q14681Q9NWC5Q9NXV2 | 0:0:0:0 | hu.MAP2 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | ELISA | 1 | 26775013 |
Sequence, Structure & Domains
Sequences
Length
542
Mass
59,572
Sequence
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFELNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P43003-1; Sequence=Displayed; Name=2; Synonyms=EAAT1ex9skip; IsoId=P43003-2; Sequence=VSP_043913
Alternative Sequence
430..475; SITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFL -> R (in isoform 2)
3D Structural Models
Turn
365..367; 378..380
Helix
41..45; 76..81; 83..95; 102..104; 106..109; 114..117; 121..136; 262..265; 274..277; 283..300; 316..328; 332..335; 347..351; 353..362; 369..377; 387..396; 400..407; 411..414; 424..439; 446..449; 451..456; 462..464; 465..473; 475..487; 493..497; 499..504
3D Structure
Electron microscopy (1); X-ray crystallography (4)
Domain & Motif Annotations
Domain (CC)
Contains eight transmembrane regions plus two helical hairpins that dip into the membrane. These helical hairpin structures play an important role in the transport process. The first enters the membrane from the cytoplasmic side, the second one from the extracellular side. During the transport cycle, the regions involved in amino acid transport, and especially the helical hairpins, move vertically by about 15-18 Angstroms, alternating between exposure to the aqueous phase and reinsertion in the lipid bilayer. In contrast, the regions involved in trimerization do not move.
Protein Families
- Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
- SLC1A3 subfamily
Sequence Similarities
Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A3 subfamily.