Protein detail
SATT
Neutral amino acid transporter A (Alanine/serine/cysteine/threonine transporter 1) (ASCT-1) (Solute carrier family 1 member 4)
Entry name SATT | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count 8 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neutral amino acid transporter A (Alanine/serine/cysteine/threonine transporter 1) (ASCT-1) (Solute carrier family 1 member 4)
Protein Class (7)
Disease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Potential drug targets
Transmembrane
42..67; Helical; Name=1; 81..102; Helical; Name=2; 117..139; Helical; Name=3; 217..240; Helical; Name=4; 250..277; Helical; Name=5; 299..320; Helical; Name=6; 366..392; Helical; Name=7; 453..474; Helical; Name=8
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ASCT-1ASCT1SATT
Gene Description
Solute carrier family 1 member 4
Chromosome
2
Position
64988477-65023865
Supporting publications (n)
4
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificBergmann glia
Function & Pathway
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Potential drug targets
Cellular Component (8)
Molecular Function (11)
- GO:0005254 chloride channel activity
- GO:0015171 amino acid transmembrane transporter activity
- GO:0015180 L-alanine transmembrane transporter activity
- GO:0015183 L-aspartate transmembrane transporter activity
- GO:0015184 L-cystine transmembrane transporter activity
- GO:0015186 L-glutamine transmembrane transporter activity
- GO:0015193 L-proline transmembrane transporter activity
- GO:0015194 L-serine transmembrane transporter activity
- GO:0015195 L-threonine transmembrane transporter activity
- GO:0015293 symporter activity
Page 1 of 2
Biological Process (3)
Reactome (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence23
Ligand-Receptor Signaling (21)
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| extracellular | extracellular | OmniPath | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transporter | transporter | Surfaceome | Yes | ||||
| solute_carrier | transporter | Almen2009 | Yes | ||||
| slc1 | transporter | Surfaceome | Yes | ||||
| slc | transporter | Surfaceome | Yes |
Page 1 of 3Next
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient Centrifugation | Mass spectrometryWestern blotting | 1 | 37820772 |
Sequence, Structure & Domains
Sequences
Length
532
Mass
55,723
Sequence
MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGAALRGLSLSRTQVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAYFGLTTLSASALAVALAFIIKPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSKIVEMKDIIVLVTSLGKYIFASILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P43007-1; Sequence=Displayed; Name=2; IsoId=P43007-2; Sequence=VSP_042880, VSP_042881
Alternative Sequence
1..220; Missing (in isoform 2); 267..345; WYVPVGIMFLVGSKIVEMKDIIVLVTSLGKYIFASILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSS -> C (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
1..10; Polar residues; 14..25; Low complexity
Domain (CC)
The transport domain consists of four transmembrane regions 3, 6, 7 and 8 and two helical hairpins HP1 and HP2. According to the one-gate elevator transport model, substrate binding and release is controlled by the helical hairpin 2 (HP2) which acts as a gate for the transport domain. HP2 gate opening enables substrate binding or release. The gate closes once one amino acid and up to three sodium ions bind to the transport domain, which subsequently triggers transmembrane elevator-like motion of the transporter across the plasma membrane.; DOMAIN: The beta-hairpin (aa 191-216) located between the helical segments of TM4 protrudes in the extracellular space and forms a docking platform for proteins of retroviral origin.
Region
1..25; Disordered; 191..216; Beta-hairpin; 500..532; Disordered
Protein Families (2)
- Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
- SLC1A4 subfamily
Sequence Similarities
Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A4 subfamily.
Clinical Relevance
Disease Involvement (3)
Disease variantEpilepsyIntellectual disability
Related Diseases (2)
Drugs
Interaction Protein (2)
ENSG00000105281ENSG00000106688
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellbiogrid_bioplex
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No related sentences available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 37204515 | Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma. | No related sentences available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No related sentences available |