Protein detail
GUC1A
Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A)
Entry name GUC1A | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Guanylyl cyclase-activating protein 1 (GCAP 1) (Guanylate cyclase activator 1A)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Eye disease
Ensembl
Entrez Gene Symbol
Gene Synonym (8)
C6orf131COD3CORD14dJ139D8.6GCAPGCAP1GUCAGUCA1
Gene Description
Guanylate cyclase activator 1A
Chromosome
6
Position
42173364-42181338
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization3
Cell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificependymal cellBlood Cell Specificplasmacytoid DC
Function & Pathway7
Protein Function (3)
- Disease related genes
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Eye disease
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Reactome (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence9
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| ligand | ligand | scConnect | Yes | No | No | No | No |
| ligand | ligand | Guide2Pharma | Yes | No | No | No | No |
| ligand | ligand | OmniPath | Yes | No | No | No | No |
Protein Complex Composition (1)
Sequence, Structure & Domains5
Sequences
Length
201
Mass
22,920
Sequence
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
Domain & Motif Annotations
Domain (CC)
Binds three calcium ions (via EF-hands 2, 3 and 4) when calcium levels are high. Binds Mg(2+) when calcium levels are low.
Domain (FT)
31..49; EF-hand 1; 51..86; EF-hand 2; 87..122; EF-hand 3; 131..166; EF-hand 4
Clinical Relevance3
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |