Protein detail
KI3L1
Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/CL-11) (CD antigen CD158e)
Protein symbol KI3L1 | UniProt ID | EVMP score 0.25 |
Frequency 2 | Transmembrane count 1 | Protein classification |
Basic Information
Protein Names
Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/CL-11) (CD antigen CD158e)
Protein Function
CD markers
Transmembrane
341..360; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Frequency
2
EVMP Score
0.25
Fluorescence & Localization
Cell SpecificAdrenal cortex cells
Function & Pathway
Protein Function
CD markers
Cellular Component
Molecular Function
Biological Process
KEGG
Reactome
Mediation Categories
Immune mediation
Relations & Evidence
Enzyme-Mediated Modification
9 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| KIR3DL1 | CSNK1D | P48730 | S | 388 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17911614SIGNOR:17911614 |
| KIR3DL1 | CSNK1D | P48730 | S | 385 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17911614SIGNOR:17911614 |
| KIR3DL1 | PRKCE | Q02156 | S | 415 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17911614SIGNOR:17911614 |
| KIR3DL1 | PRKCG | P05129 | S | 415 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17911614SIGNOR:17911614 |
| KIR3DL1 | CDK3 | Q00526 | S | 296 | phosphorylation | MIMPHPRDHPRD_MIMPKEA | HPRD:11733001KEA:11733001 |
| KIR3DL1 | CSNK2A1 | P68400 | S | 388 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| KIR3DL1 | CSNK2A1 | P68400 | S | 385 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| KIR3DL1 | PRKCB | P05771 | S | 415 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| KIR3DL1 | PRKCA | P17252 | S | 415 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
Regulatory Interaction Network
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | KI3L1 | P43629 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_ProtMapper | SIGNOR:17911614 |
| KPCB | P05771 | KI3L1 | P43629 | Yes | No | Yes | PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_ProtMapper | SIGNOR:17911614 |
| CSK21 | P68400 | KI3L1 | P43629 | Yes | Yes | No | PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_ProtMapper | SIGNOR:17911614 |
| KPCE | Q02156 | KI3L1 | P43629 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:17911614SIGNOR:17911614 |
| KC1D | P48730 | KI3L1 | P43629 | Yes | Yes | No | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:17911614PhosphoSite:17911614SIGNOR:17911614 |
| KPCG | P05129 | KI3L1 | P43629 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:17911614SIGNOR:17911614 |
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
444
Mass
49,098
Sequence
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P43629-1; Sequence=Displayed; Name=2; IsoId=P43629-2; Sequence=VSP_047633
Alternative Sequence
25..119; Missing (in isoform 2)
3D Structural Models
Turn
202..204; 258..260
Helix
70..73; 87..89; 187..189
Beta Strand
30..35; 37..40; 45..51; 52..55; 57..64; 66..68; 76..78; 80..82; 91..98; 100..106; 113..118; 125..130; 132..135; 140..148; 151..157; 165..168; 170..172; 175..182; 191..198; 213..218; 225..230; 232..234; 241..248; 251..257; 264..267; 269..271; 272..274; 276..281; 289..297; 300..304; 311..313
3D Structure
X-ray crystallography (18)
Domain & Motif Annotations
Compositional Bias
319..333; Low complexity
Domain (CC)
Ig-like C2-type domain 2 mediates specificity through recognition of the Bw4 epitope.
Domain (FT)
42..102; Ig-like C2-type 1; 137..202; Ig-like C2-type 2; 237..300; Ig-like C2-type 3
Region
315..334; Disordered; 375..394; Disordered; 409..444; Disordered
Protein Families
Immunoglobulin superfamily
Sequence Similarities
Belongs to the immunoglobulin superfamily.