Protein detail

KI3L1

Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/CL-11) (CD antigen CD158e)

Protein symbol KI3L1	UniProt ID P43629	EVMP score 0.25
Frequency 2	Transmembrane count 1	Protein classification

Basic Information

Protein Names

Protein Function

CD markers

Transmembrane

341..360; Helical

Transmembrane Count

Ensembl

ENSG00000167633

Entrez Gene Symbol

KIR3DL1

Frequency

EVMP Score

0.25

Fluorescence & Localization

Cell SpecificAdrenal cortex cells

Function & Pathway

Protein Function

CD markers

Cellular Component

GO:0005886 plasma membrane

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Immune mediation

Relations & Evidence

Enzyme-Mediated Modification

9 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
KIR3DL1	CSNK1D	P48730	S	388	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	CSNK1D	P48730	S	385	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	PRKCE	Q02156	S	415	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	PRKCG	P05129	S	415	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	CDK3	Q00526	S	296	phosphorylation	MIMPHPRDHPRD_MIMPKEA	HPRD:11733001 KEA:11733001
KIR3DL1	CSNK2A1	P68400	S	388	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
KIR3DL1	CSNK2A1	P68400	S	385	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
KIR3DL1	PRKCB	P05771	S	415	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
KIR3DL1	PRKCA	P17252	S	415	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling

51 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 6 of 6Previous

Regulatory Interaction Network

6 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCA	P17252	KI3L1	P43629	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_ProtMapper	SIGNOR:17911614
KPCB	P05771	KI3L1	P43629	Yes	No	Yes	PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_ProtMapper	SIGNOR:17911614
CSK21	P68400	KI3L1	P43629	Yes	Yes	No	PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_ProtMapper	SIGNOR:17911614
KPCE	Q02156	KI3L1	P43629	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KC1D	P48730	KI3L1	P43629	Yes	Yes	No	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 PhosphoSite:17911614 SIGNOR:17911614
KPCG	P05129	KI3L1	P43629	Yes	No	Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614

Protein Complex Composition

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
KIR2DS1 KIR2DS2 KIR2DS5 KIR3DL1	P43629 P43631 Q14953 Q14954	0:0:0:0	hu.MAP2
KIR3DL1 KIR3DS1 LCN2	P43629 P80188 Q14943	0:0:0	hu.MAP2
KIR3DL1 KIR3DS1	P43629 Q14943	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blotting	2	40748658 30646616

Sequence, Structure & Domains

Sequences

Length

444

Mass

49,098

Sequence

MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P43629-1; Sequence=Displayed; Name=2; IsoId=P43629-2; Sequence=VSP_047633

Alternative Sequence

25..119; Missing (in isoform 2)

3D Structural Models

Turn

202..204; 258..260

Helix

70..73; 87..89; 187..189

Beta Strand

30..35; 37..40; 45..51; 52..55; 57..64; 66..68; 76..78; 80..82; 91..98; 100..106; 113..118; 125..130; 132..135; 140..148; 151..157; 165..168; 170..172; 175..182; 191..198; 213..218; 225..230; 232..234; 241..248; 251..257; 264..267; 269..271; 272..274; 276..281; 289..297; 300..304; 311..313

3D Structure

X-ray crystallography (18)

Domain & Motif Annotations

Compositional Bias

319..333; Low complexity

Domain (CC)

Ig-like C2-type domain 2 mediates specificity through recognition of the Bw4 epitope.

Domain (FT)

42..102; Ig-like C2-type 1; 137..202; Ig-like C2-type 2; 237..300; Ig-like C2-type 3

Region

315..334; Disordered; 375..394; Disordered; 409..444; Disordered

Protein Families

Immunoglobulin superfamily

Sequence Similarities

Belongs to the immunoglobulin superfamily.

Clinical Relevance