Protein detail

KI3L1

Killer cell immunoglobulin-like receptor 3DL1 (CD158 antigen-like family member E) (HLA-BW4-specific inhibitory NK cell receptor) (Natural killer-associated transcript 3) (NKAT-3) (p70 natural killer cell receptor clones CL-2/CL-11) (p70 NK receptor CL-2/CL-11) (CD antigen CD158e)

Entry name KI3L1	UniProt ID P43629	EVMP confidence score 0.53
Supporting publications (n) 2	Transmembrane count 1	Protein classification

Basic Information

Protein Names

Protein Function

CD markers

Transmembrane

341..360; Helical

Transmembrane Count

Ensembl

ENSG00000167633

Entrez Gene Symbol

KIR3DL1

Supporting publications (n)

EVMP confidence score

0.53

Fluorescence & Localization

Cell SpecificAdrenal cortex cells

Function & Pathway

Protein Function

CD markers

Cellular Component

GO:0005886 plasma membrane

Molecular Function (3)

Biological Process (3)

KEGG (3)

Reactome (2)

Mediation Categories

Immune mediation

Relations & Evidence70

Enzyme-Mediated Modification (9)

9 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
KIR3DL1	CSNK1D	P48730	S	388	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	CSNK1D	P48730	S	385	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	PRKCE	Q02156	S	415	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	PRKCG	P05129	S	415	phosphorylation	PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KIR3DL1	CDK3	Q00526	S	296	phosphorylation	MIMPHPRDHPRD_MIMPKEA	HPRD:11733001 KEA:11733001
KIR3DL1	CSNK2A1	P68400	S	388	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
KIR3DL1	CSNK2A1	P68400	S	385	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
KIR3DL1	PRKCB	P05771	S	415	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
KIR3DL1	PRKCA	P17252	S	415	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (51)

51 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane_predicted	Phobius				Yes

Page 6 of 6Previous

Regulatory Interaction Network (6)

6 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCA	P17252	KI3L1	P43629	Yes		Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_ProtMapper	SIGNOR:17911614
KPCB	P05771	KI3L1	P43629	Yes		Yes	PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_ProtMapper	SIGNOR:17911614
CSK21	P68400	KI3L1	P43629	Yes	Yes		PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_ProtMapper	SIGNOR:17911614
KPCE	Q02156	KI3L1	P43629	Yes		Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614
KC1D	P48730	KI3L1	P43629	Yes	Yes		PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:17911614 PhosphoSite:17911614 SIGNOR:17911614
KPCG	P05129	KI3L1	P43629	Yes		Yes	PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:17911614 SIGNOR:17911614

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
KIR2DS1 KIR2DS2 KIR2DS5 KIR3DL1	P43629 P43631 Q14953 Q14954	0:0:0:0	hu.MAP2
KIR3DL1 KIR3DS1 LCN2	P43629 P80188 Q14943	0:0:0	hu.MAP2
KIR3DL1 KIR3DS1	P43629 Q14943	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blotting	2	40748658 30646616

Sequence, Structure & Domains

Sequences

Length

444

Mass

49,098

Sequence

MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P43629-1; Sequence=Displayed; Name=2; IsoId=P43629-2; Sequence=VSP_047633

Alternative Sequence

25..119; Missing (in isoform 2)

3D Structural Models

Turn

202..204; 258..260

Helix

70..73; 87..89; 187..189

Beta Strand

30..35; 37..40; 45..51; 52..55; 57..64; 66..68; 76..78; 80..82; 91..98; 100..106; 113..118; 125..130; 132..135; 140..148; 151..157; 165..168; 170..172; 175..182; 191..198; 213..218; 225..230; 232..234; 241..248; 251..257; 264..267; 269..271; 272..274; 276..281; 289..297; 300..304; 311..313

3D Structure

X-ray crystallography (18)

Domain & Motif Annotations

Compositional Bias

319..333; Low complexity

Domain (CC)

Ig-like C2-type domain 2 mediates specificity through recognition of the Bw4 epitope.

Domain (FT)

42..102; Ig-like C2-type 1; 137..202; Ig-like C2-type 2; 237..300; Ig-like C2-type 3

Region

315..334; Disordered; 375..394; Disordered; 409..444; Disordered

Protein Families

Immunoglobulin superfamily

Sequence Similarities

Belongs to the immunoglobulin superfamily.

Supporting Publications2

PMID	Title	Related sentences
38037300	Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles.	No related sentences available
39773168	TGF-β Receptor-dependent Tissue Factor Release and Proteomic Profiling of Extracellular Vesicles from Mechanically Compressed Human Bronchial Epithelial Cells.	No related sentences available