Protein detail
LPAR6
Lysophosphatidic acid receptor 6 (LPA receptor 6) (LPA-6) (Oleoyl-L-alpha-lysophosphatidic acid receptor) (P2Y purinoceptor 5) (P2Y5) (Purinergic receptor 5) (RB intron encoded G-protein coupled receptor)
Entry name LPAR6 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 2 | Transmembrane count 7 | Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Lysophosphatidic acid receptor 6 (LPA receptor 6) (LPA-6) (Oleoyl-L-alpha-lysophosphatidic acid receptor) (P2Y purinoceptor 5) (P2Y5) (Purinergic receptor 5) (RB intron encoded G-protein coupled receptor)
Protein Class (5)
Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteins
Protein Function (6)
- G-protein coupled receptors:Lysolipids receptors
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
Transmembrane
20..46; Helical; Name=1; 56..79; Helical; Name=2; 93..112; Helical; Name=3; 134..154; Helical; Name=4; 182..209; Helical; Name=5; 228..253; Helical; Name=6; 273..292; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
P2RY5P2Y5
Gene Description
Lysophosphatidic acid receptor 6
Chromosome
13
Position
48389567-48444704
Supporting publications (n)
2
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway
Protein Function (6)
- G-protein coupled receptors:Lysolipids receptors
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
Cellular Component
Molecular Function (2)
Biological Process (3)
KEGG (4)
Reactome (6)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence53
Ligand-Receptor Signaling (38)
38 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr | receptor | Surfaceome | Yes | Yes | |||
| class_a_rhodopsin | receptor | GPCRdb | Yes | Yes | |||
| class_a_rhodopsin_lipid | receptor | GPCRdb | Yes | Yes | |||
| class_a_rhodopsin_lipid_lysophospholipid_lpa | receptor | GPCRdb | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | HPMR | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes |
Regulatory Interaction Network (12)
12 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LPAR6 | P43657 | GNAS2 | P63092 | Yes | Yes | SIGNOR | SIGNOR:23182454 | |
| LPAR6 | P43657 | GNAS1 | Q5JWF2 | Yes | Yes | SIGNOR | SIGNOR:23182454 |
Page 2 of 2Previous
Protein Complex Composition (2)
Sequence, Structure & Domains
Sequences
Length
344
Mass
39,392
Sequence
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
3D Structural Models
Turn
123..127
Helix
16..44; 51..67; 70..79; 86..119; 130..145; 149..152; 174..179; 181..192; 194..209; 228..257; 263..275; 278..282; 283..285; 287..290; 296..298
Beta Strand
168..171; 216..220; 225..227; 292..295
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Disease Involvement (2)
Disease variantHypotrichosis
Related Diseases
Drugs
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |
| 37403840 | Phosphoproteome analysis of cerebrospinal fluid extracellular vesicles in primary central nervous system lymphoma. | No related sentences available |