Protein detail
SC6A9
Sodium- and chloride-dependent glycine transporter 1 (GlyT-1) (GlyT1) (Solute carrier family 6 member 9)
Entry name SC6A9 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 12 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sodium- and chloride-dependent glycine transporter 1 (GlyT-1) (GlyT1) (Solute carrier family 6 member 9)
Protein Class (8)
Disease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of amino acid metabolism
Transmembrane
109..129; Helical; Name=1; 136..156; Helical; Name=2; 188..208; Helical; Name=3; 286..306; Helical; Name=4; 315..335; Helical; Name=5; 360..380; Helical; Name=6; 407..427; Helical; Name=7; 450..470; Helical; Name=8; 506..526; Helical; Name=9; 530..550; Helical; Name=10; 570..590; Helical; Name=11; 610..630; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
GlyT-1GLYT1
Gene Description
Solute carrier family 6 member 9
Chromosome
1
Position
43991500-44031467
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificmedium spiny neuronBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of amino acid metabolism
Cellular Component (14)
- GO:0005768 endosome
- GO:0005886 plasma membrane
- GO:0009925 basal plasma membrane
- GO:0014069 postsynaptic density
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0030672 synaptic vesicle membrane
- GO:0031045 dense core granule
Page 1 of 2
Molecular Function (2)
Biological Process (3)
Reactome (3)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence49
Enzyme-Mediated Modification (15)
15 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC6A9 | PRKCA | P17252 | S | 698 | phosphorylation | MIMPHPRD_MIMPPhosphoSite_MIMP | |
| SLC6A9 | PRKCA | P17252 | T | 92 | phosphorylation | MIMPHPRD_MIMP | |
| SLC6A9 | PRKCA | P17252 | S | 312 | phosphorylation | MIMPHPRD_MIMP | |
| SLC6A9 | PRKCA | P17252 | T | 349 | phosphorylation | MIMPHPRD_MIMP | |
| SLC6A9 | PRKCA | P17252 | T | 663 | phosphorylation | MIMPHPRD_MIMP |
Page 2 of 2Previous
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| solute_carrier | transporter | Almen2009 | Yes | ||||
| slc6 | transporter | Surfaceome | Yes | ||||
| slc | transporter | Surfaceome | Yes | ||||
| transporter | transporter | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | CellPhoneDB | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCB | P05771 | SC6A9 | P48067 | Yes | Yes | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:21864610SIGNOR:21864610 | |
| KPCA | P17252 | SC6A9 | P48067 | Yes | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | ProtMapper:21864610HPRD:7595479SIGNOR:21864610ProtMapper:7595479KEA:7595479 |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Glycine_bySHMT1_and_SLC6A9 | SHMT1SLC6A9 | P34896P48067 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:Glycine_bySHMT1_and_SLC6A9 | |
| Glycine_bySHMT2_and_SLC6A9 | SHMT2SLC6A9 | P34897P48067 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:Glycine_bySHMT2_and_SLC6A9 | |
| LSM2LSM4LSM6LSM7LSM8MEPCEPRPF3PRPF4SART3SLC6A9SLTMSNRPD2 | O43172O43395O95777P48067P62312P62316Q15020Q7L2J0Q9NWH9Q9UK45Q9Y333Q9Y4Z0 | 1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7587 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30550287 |
Sequence, Structure & Domains
Sequences
Length
706
Mass
78,260
Sequence
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=GlyT-1C; IsoId=P48067-1; Sequence=Displayed; Name=GlyT-1A; IsoId=P48067-2; Sequence=VSP_006270; Name=GlyT-1B; IsoId=P48067-3; Sequence=VSP_006271
Alternative Sequence
1..83; MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQ -> MVGKGAKGML (in isoform GlyT-1A); 29..82; Missing (in isoform GlyT-1B)
3D Structural Models
Turn
103..105; 272..274; 373..375; 550..552; 597..601; 633..636; 663..665
Helix
106..117; 120..123; 125..132; 135..137; 139..148; 150..164; 170..173; 176..179; 180..209; 264..271; 288..306; 309..311; 313..319; 322..334; 340..348; 358..372; 378..383; 392..425; 439..448; 454..488; 491..494; 497..512; 513..516; 520..530; 535..549; 553..564; 570..593; 607..621; 623..632; 640..648; 659..661
Beta Strand
212..214; 218..220; 258..260; 278..281; 335..339; 354..357; 429..433; 435..437; 451..453; 532..534; 655..657
3D Structure
Electron microscopy (7); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
7..18; Low complexity
Region
1..26; Disordered; 695..706; Essential for interaction with EXOC1
Protein Families (2)
- Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family
- SLC6A9 subfamily
Sequence Similarities
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A9 subfamily.
Clinical Relevance
Disease Involvement
Disease variant
Related Diseases (3)
Biomarker
Investigative; Phase 2; Phase 3
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37886648 | Pathological mechanisms of type 1 diabetes in children: investigation of the exosomal protein expression profile. | No related sentences available |