Protein detail
SC6A9
Sodium- and chloride-dependent glycine transporter 1 (GlyT-1) (GlyT1) (Solute carrier family 6 member 9)
Protein symbol SC6A9 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 12 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Sodium- and chloride-dependent glycine transporter 1 (GlyT-1) (GlyT1) (Solute carrier family 6 member 9)
Protein Class
Disease related genesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of amino acid metabolism
Transmembrane
109..129; Helical; Name=1; 136..156; Helical; Name=2; 188..208; Helical; Name=3; 286..306; Helical; Name=4; 315..335; Helical; Name=5; 360..380; Helical; Name=6; 407..427; Helical; Name=7; 450..470; Helical; Name=8; 506..526; Helical; Name=9; 530..550; Helical; Name=10; 570..590; Helical; Name=11; 610..630; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym
GlyT-1GLYT1
Gene Description
Solute carrier family 6 member 9
Chromosome
1
Position
43991500-44031467
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificmedium spiny neuronBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of amino acid metabolism
Cellular Component
- GO:0005768 endosome
- GO:0005886 plasma membrane
- GO:0009925 basal plasma membrane
- GO:0014069 postsynaptic density
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0030672 synaptic vesicle membrane
- GO:0031045 dense core granule
- GO:0042734 presynaptic membrane
- GO:0045211 postsynaptic membrane
- GO:0098686 hippocampal mossy fiber to CA3 synapse
- GO:0098688 parallel fiber to Purkinje cell synapse
Molecular Function
Biological Process
Reactome
Mediation Categories
Clinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
15 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC6A9 | PRKCB | P05771 | T | 590 | phosphorylation | SIGNOR | SIGNOR:21864610 |
| SLC6A9 | PRKCB | P05771 | T | 276 | phosphorylation | SIGNOR | SIGNOR:21864610 |
| SLC6A9 | PRKCB | P05771 | S | 625 | phosphorylation | SIGNOR | SIGNOR:21864610 |
| SLC6A9 | PRKCB | P05771 | T | 19 | phosphorylation | SIGNOR | SIGNOR:21864610 |
| SLC6A9 | PRKCB | P05771 | S | 239 | phosphorylation | SIGNOR | SIGNOR:21864610 |
| SLC6A9 | PRKCA | P17252 | T | 276 | phosphorylation | KEASIGNOR | KEA:7595479SIGNOR:21864610 |
| SLC6A9 | PRKCA | P17252 | S | 239 | phosphorylation | KEASIGNOR | KEA:7595479SIGNOR:21864610 |
| SLC6A9 | PRKCA | P17252 | S | 625 | phosphorylation | KEASIGNOR | KEA:7595479SIGNOR:21864610 |
| SLC6A9 | PRKCA | P17252 | T | 590 | phosphorylation | KEASIGNOR | KEA:7595479SIGNOR:21864610 |
| SLC6A9 | PRKCA | P17252 | T | 19 | phosphorylation | KEASIGNOR | KEA:7595479SIGNOR:21864610 |
Page 1 of 2Next
Ligand-Receptor Signaling
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 3 of 3Previous
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCB | P05771 | SC6A9 | P48067 | Yes | No | Yes | SIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:21864610SIGNOR:21864610 |
| KPCA | P17252 | SC6A9 | P48067 | Yes | No | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | ProtMapper:21864610HPRD:7595479SIGNOR:21864610ProtMapper:7595479KEA:7595479 |
Protein Complex Composition
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Glycine_bySHMT1_and_SLC6A9 | SHMT1SLC6A9 | P34896P48067 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:Glycine_bySHMT1_and_SLC6A9 | |
| Glycine_bySHMT2_and_SLC6A9 | SHMT2SLC6A9 | P34897P48067 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:Glycine_bySHMT2_and_SLC6A9 | |
| LSM2LSM4LSM6LSM7LSM8MEPCEPRPF3PRPF4SART3SLC6A9SLTMSNRPD2 | O43172O43395O95777P48067P62312P62316Q15020Q7L2J0Q9NWH9Q9UK45Q9Y333Q9Y4Z0 | 1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7587 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30550287 |
Sequence, Structure & Domains
Sequences
Length
706
Mass
78,260
Sequence
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=GlyT-1C; IsoId=P48067-1; Sequence=Displayed; Name=GlyT-1A; IsoId=P48067-2; Sequence=VSP_006270; Name=GlyT-1B; IsoId=P48067-3; Sequence=VSP_006271
Alternative Sequence
1..83; MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQ -> MVGKGAKGML (in isoform GlyT-1A); 29..82; Missing (in isoform GlyT-1B)
3D Structural Models
Turn
103..105; 272..274; 373..375; 550..552; 597..601; 633..636; 663..665
Helix
106..117; 120..123; 125..132; 135..137; 139..148; 150..164; 170..173; 176..179; 180..209; 264..271; 288..306; 309..311; 313..319; 322..334; 340..348; 358..372; 378..383; 392..425; 439..448; 454..488; 491..494; 497..512; 513..516; 520..530; 535..549; 553..564; 570..593; 607..621; 623..632; 640..648; 659..661
Beta Strand
212..214; 218..220; 258..260; 278..281; 335..339; 354..357; 429..433; 435..437; 451..453; 532..534; 655..657
3D Structure
Electron microscopy (7); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
7..18; Low complexity
Region
1..26; Disordered; 695..706; Essential for interaction with EXOC1
Protein Families
- Sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family
- SLC6A9 subfamily
Sequence Similarities
Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A9 subfamily.
Clinical Relevance
Disease Involvement
Disease variant
Related Diseases
Biomarker
Investigative; Phase 2; Phase 3
Antibody