Protein detail
MAOX
NADP-dependent malic enzyme (NADP-ME) (EC 1.1.1.40) (Malic enzyme 1)
Entry name MAOX | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
NADP-dependent malic enzyme (NADP-ME) (EC 1.1.1.40) (Malic enzyme 1)
Protein Class (4)
EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteins
Protein Function (3)
- Enzymes
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Malic enzyme 1
Chromosome
6
Position
83210402-83431051
Supporting publications (n)
1
EVMP confidence score
0.40
Function & Pathway
Protein Function (3)
- Enzymes
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (11)
- GO:0000287 magnesium ion binding
- GO:0004470 malic enzyme activity
- GO:0004473 malate dehydrogenase (decarboxylating) (NADP+) activity
- GO:0005515 protein binding
- GO:0008948 oxaloacetate decarboxylase activity
- GO:0009055 electron transfer activity
- GO:0030145 manganese ion binding
- GO:0042802 identical protein binding
- GO:0043531 ADP binding
- GO:0050661 NADP binding
Page 1 of 2
Biological Process (3)
KEGG (4)
Reactome (9)
- R-hsa-1428517 aerobic respiration and respiratory electron transport
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711123 cellular response to chemical stress
- R-hsa-9755511 keap1 nfe2l2 pathway
- R-hsa-556833 metabolism of lipids
- R-hsa-9759194 nuclear events mediated by nfe2l2
- R-hsa-70268 pyruvate metabolism
- R-hsa-400206 regulation of lipid metabolism by pparalpha
- R-hsa-9861718 regulation of pyruvate metabolism
Mediation Categories
Metabolism mediation
Relations & Evidence62
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ME1 | NEK1 | Q96PY6 | S | 336 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| NEK1 | Q96PY6 | MAOX | P48163 | Yes | Yes | SIGNORProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:31735643ProtMapper:31735643SIGNOR:31735643 | |
| SIR6 | Q8N6T7 | MAOX | P48163 | Yes | Yes | SIGNOR | SIGNOR:31735643 | |
| PGAM5 | Q96HS1 | MAOX | P48163 | Yes | Yes | SIGNOR | SIGNOR:31735643 | |
| THIL | P24752 | MAOX | P48163 | Yes | Yes | SIGNOR | SIGNOR:31735643 |
Protein Complex Composition (51)
51 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster306 | PSME1PSME2PSME3PSME3IP1 | P61289Q06323Q9GZU8Q9UL46 | 1:1:1:1 | Compleat | Compleat:HC3581 | 22036573 |
| HT_DM_Cluster65 | DNASE2DNASE2BISYNA1NME1NME2NME3TCEA1TCEA2TCEA3UBR7 | O00115O75764P15531P22392P23193Q13232Q15560Q8N806Q8WZ79Q9NPH2 | 1:1:1:1:1:1:1:1:1:1 | Compleat | Compleat:HC3264 | 22036573 |
| HT_SC_Cluster146 | TOMM40TOMM40LYME1L1 | O96008Q969M1Q96TA2 | 1:1:1 | Compleat | Compleat:HC1126 | |
| Holliday junction resolvase complex | EME1MUS81 | Q96AY2Q96NY9 | 2:2 | hu.MAPKEGG-MEDICUSComplexPortalCompleathu.MAP2SPIKEPDB | PDB:9f9aPDB:4p0sPDB:2zixCompleat:HC1220PDB:9f98PDB:9f9lPDB:4p0pintact:EBI-11893062PDB:9f9mPDB:9f99PDB:4p0qPDB:4p0rPDB:9f9k | 24733841173638971475529218413719 |
| Hydride transfer complex | MDH1ME1PC | P11498P40925P48163 | 4:2:4 | ComplexPortal | intact:EBI-27104668 | 3454724114755292 |
| NDPKA-AMPKalpha1 complex | NME1PRKAA1 | P15531Q13131 | 1:1 | CompleatCORUM | Compleat:HC3425CORUM:771 | 16026327 |
| PA28 complex | PSME1PSME2 | Q06323Q9UL46 | 1:1 | CompleatCORUM | CORUM:30Compleat:HC3134 | 9325261 |
| PA28-20S proteasome | PSMA1PSMA2PSMA3PSMA4PSMA5PSMA6PSMA7PSMB1PSMB2PSMB3PSMB4PSMB5PSMB6PSMB7PSME1PSME2 | O14818P20618P25786P25787P25788P25789P28066P28070P28072P28074P49720P49721P60900Q06323Q99436Q9UL46 | 2:2:2:2:2:2:2:2:2:2:2:2:2:2:2:2 | CORUMCompleatComplexPortalPDB | PDB:8cxbPDB:8CXBintact:EBI-52345851PDB:7NAOPDB:7napCORUM:192PDB:7NAPintact:EBI-50432751Compleat:HC3027PDB:7nao | 357147703585837526892607116765311475529233498876 |
| Prune/Nm23-H1 complex | NME1PRUNE1 | P15531Q86TP1 | 1:1 | CompleatCORUM | CORUM:758Compleat:HC1006 | 14998490 |
| LSM8NME1NME2NME3NME4RPS16STRAPUBCYJU2 | O00746O95777P0CG48P15531P22392P62249Q13232Q9BW85Q9Y3F4 | 1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9296 |
Page 1 of 6Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 37330168 |
Sequence, Structure & Domains
Sequences
Length
572
Mass
64,150
Sequence
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P48163-1; Sequence=Displayed; Name=2; IsoId=P48163-2; Sequence=VSP_057051
Alternative Sequence
1..75; Missing (in isoform 2)
3D Structural Models
Turn
22..24; 41..43; 157..159; 260..262; 268..270; 424..426
Helix
16..19; 27..29; 32..37; 51..64; 68..79; 83..91; 94..101; 105..111; 113..116; 127..129; 133..137; 163..167; 168..181; 185..187; 200..204; 218..236; 249..259; 271..288; 292..294; 304..319; 324..329; 349..352; 364..371; 388..397; 410..412; 417..423; 454..456; 458..468; 475..487; 491..495; 503..505; 506..523; 536..541; 561..564
Beta Strand
122..126; 147..151; 153..156; 188..194; 240..244; 263..267; 297..301; 331..335; 374..378; 402..405; 429..434; 529..531
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Protein Families
Malic enzymes family
Sequence Similarities
Belongs to the malic enzymes family.
Clinical Relevance
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 36573687 | Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes. | No related sentences available |