Protein detail
CD151
CD151 antigen (GP27) (Membrane glycoprotein SFA-1) (Platelet-endothelial tetraspan antigen 3) (PETA-3) (Tetraspanin-24) (Tspan-24) (CD antigen CD151)
Entry name CD151 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification Blood group antigen proteinsCD markersDisease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD151 antigen (GP27) (Membrane glycoprotein SFA-1) (Platelet-endothelial tetraspan antigen 3) (PETA-3) (Tetraspanin-24) (Tspan-24) (CD antigen CD151)
Protein Class (7)
Blood group antigen proteinsCD markersDisease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (8)
- Human disease related genes:Urinary system diseases:Kidney diseases
- Blood group antigen proteins
- CD markers
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Transmembrane
19..39; Helical; 58..78; Helical; 92..112; Helical; 222..242; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
PETA-3RAPHSFA-1TSPAN24
Gene Description
CD151 molecule (Raph blood group)
Chromosome
11
Position
832887-839831
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization2
Tissue SpecificretinaCell SpecificCone photoreceptor cells
Function & Pathway6
Protein Function (8)
- Human disease related genes:Urinary system diseases:Kidney diseases
- Blood group antigen proteins
- CD markers
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (6)
Molecular Function (2)
Biological Process (3)
Reactome (6)
Mediation Categories (3)
Adhesion and uptake mediationImmune mediationReceptor-signaling mediation
Relations & Evidence30
Ligand-Receptor Signaling (29)
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 3 of 3Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37438638 |
Sequence, Structure & Domains5
Sequences
Length
253
Mass
28,295
Sequence
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
Domain & Motif Annotations
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance5
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |