Protein detail

MRP

MARCKS-related protein (MARCKS-like protein 1) (Macrophage myristoylated alanine-rich C kinase substrate) (Mac-MARCKS) (MacMARCKS)

Entry name MRP	UniProt ID P49006	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

MARCKS-related protein (MARCKS-like protein 1) (Macrophage myristoylated alanine-rich C kinase substrate) (Mac-MARCKS) (MacMARCKS)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000175130

Entrez Gene Symbol

MARCKSL1

Gene Synonym (4)

F52MacMARCKSMLPMLP1

Gene Description

MARCKS like 1

Chromosome

Position

32333839-32336233

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization7

Tissue Specificlymphoid tissueCell SpecificInnate lymphoid cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificT-cellsSecretome LocationSecreted to bloodSecretome FunctionCytokine

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Canonical Pathways (3)

M243 Pid arf 3pathway
M86 Pid arf6 pathway
M141 Pid pi3kci pathway

Mediation Categories

Fusion and delivery mediation

Relations & Evidence16

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
MARCKSL1	ATR	Q13535	S	71	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEAPhosphoSitePhosphoSite_ProtMapper	KEA:18077418
MARCKSL1	PKM	P14618	S	104	phosphorylation	KEA	KEA:8132675
MARCKSL1	PKM	P14618	S	93	phosphorylation	KEA	KEA:8132675

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (6)

6 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
ProTalpha C2 complex	ACTB MARCKSL1 PTMA SET	P06454 P49006 P60709 Q01105	0:0:0:0	CORUM	CORUM:6984	29106904
	MARCKSL1 MRPL30 RALB ZBTB43	O43298 P11234 P49006 Q8TCC3	0:0:0:0	Havugimana2012	Havugimana2012:C_214
	EEF1B2 EIF5B HUWE1 MARCKSL1 PTMA	O60841 P06454 P24534 P49006 Q7Z6Z7	0:0:0:0:0	hu.MAP2
	HNRNPA0 HNRNPAB MARCKSL1	P49006 Q13151 Q99729	0:0:0	hu.MAP
	HNRNPAB HNRNPD MARCKSL1	P49006 Q14103 Q99729	0:0:0	hu.MAP
	HNRNPAB MARCKSL1	P49006 Q99729	0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometryWestern blottingFlow cytometryMORPH	6	37786918 34817906 28986585 38321535 32089743 33709510

Sequence, Structure & Domains7

Sequences

Length

195

Mass

19,529

Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE

Domain & Motif Annotations

Compositional Bias

16..26; Low complexity; 53..64; Low complexity; 76..85; Basic and acidic residues; 86..98; Basic residues; 153..195; Low complexity

Region

1..195; Disordered; 87..110; Effector domain involved in lipid-binding and calmodulin-binding

Protein Families

MARCKS family

Sequence Similarities

Belongs to the MARCKS family.

Clinical Relevance2

Drugs (6)

IL-6 STAUROSPORINE RECOMBINANT INTERFERON TNF-ALPHA TETRADECANOYLPHORBOL ACETATE HERBIMYCIN A

Antibody (2)

CAB020787 HPA030528

Supporting Publications1

PMID	Title	Abstract
38984872	Endometriotic Tissue-derived Exosomes Downregulate NKG2D-mediated Cytotoxicity and Promote Apoptosis: Mechanisms for Survival of Ectopic Endometrial Tissue in Endometriosis.	Acting as decoys, these exosomes downregulate the NKG2D receptor, impair NKG2D-mediated cytotoxicity, and induce apoptosis of activated PBMCs and Jurkat cells through the FasL- and TRAIL pathway. Two exosome-mediated mechanisms known to impair the immune response were investigated: 1) downregulation of NKG2D-mediated cytotoxicity and 2) FasL- and TRAIL-induced apoptosis of activated immune cells. We showed that secreted endometriotic exosomes isolated from supernatants of short-term explant cultures carry the NKG2D ligands MICA/B and ULBP1-3 and the proapoptotic molecules FasL and TRAIL on their surface, i.e., signature molecules of exosome-mediated immune suppression.