Protein detail
KLK7
Kallikrein-7 (hK7) (EC 3.4.21.117) (Serine protease 6) (Stratum corneum chymotryptic enzyme) (hSCCE)
Entry name KLK7 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 17 | Transmembrane count | Protein classification Cancer-related genesEnzymesPredicted intracellular proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Kallikrein-7 (hK7) (EC 3.4.21.117) (Serine protease 6) (Stratum corneum chymotryptic enzyme) (hSCCE)
Protein Class (4)
Cancer-related genesEnzymesPredicted intracellular proteinsPredicted secreted proteins
Protein Function (6)
- Predicted intracellular proteins
- Peptidases:Serine-type peptidases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
PRSS6SCCE
Gene Description
Kallikrein related peptidase 7
Chromosome
19
Position
50976468-50984099
Supporting publications (n)
17
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdrenal medulla cells
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- Peptidases:Serine-type peptidases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- ENZYME proteins:Hydrolases
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Reactome (5)
- R-hsa-1474228 degradation of the extracellular matrix
- R-hsa-9734767 developmental cell lineages
- R-hsa-9734779 developmental cell lineages of the integumentary system
- R-hsa-9725554 differentiation of keratinocytes in interfollicular epidermis in mammalian skin
- R-hsa-1474244 extracellular matrix organization
Mediation Categories
Immune mediation
Relations & Evidence24
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | Yes | |||
| serine_protease | secreted_peptidase | HGNC | Yes | ||||
| secreted_enzyme | secreted_enzyme | HGNC | Yes | Yes | |||
| secreted_peptidase | secreted_peptidase | HGNC | Yes | ||||
| secreted_enzyme | secreted_enzyme | OmniPath | Yes | Yes | |||
| extracellular | extracellular | LOCATE | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes |
Page 1 of 2Next
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
253
Mass
27,525
Sequence
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Long; IsoId=P49862-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P49862-2; Sequence=VSP_013581
Alternative Sequence
1..72; Missing (in isoform 2)
3D Structural Models
Turn
106..108
Helix
69..71; 173..180; 181..183; 238..240; 242..251
Beta Strand
44..49; 52..61; 64..67; 76..81; 90..95; 97..100; 114..117; 125..127; 143..150; 152..156; 164..171; 188..192; 208..211; 214..221; 224..226; 233..237
3D Structure
X-ray crystallography (12)
Domain & Motif Annotations
Domain (FT)
30..250; Peptidase S1
Protein Families (2)
- Peptidase S1 family
- Kallikrein subfamily
Sequence Similarities
Belongs to the peptidase S1 family. Kallikrein subfamily.
Clinical Relevance
Supporting Publications17
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No related sentences available |
| 30408591 | Portrait of blood-derived extracellular vesicles in patients with Parkinson's disease. | No related sentences available |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No related sentences available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No related sentences available |
| 37205098 | Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers. | No related sentences available |
Page 1 of 2Next