Protein detail
KLK7
Kallikrein-7 (hK7) (EC 3.4.21.117) (Serine protease 6) (Stratum corneum chymotryptic enzyme) (hSCCE)
Entry name KLK7 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 17 | Transmembrane count | Protein classification Cancer-related genesEnzymesPredicted intracellular proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Kallikrein-7 (hK7) (EC 3.4.21.117) (Serine protease 6) (Stratum corneum chymotryptic enzyme) (hSCCE)
Protein Class (4)
Cancer-related genesEnzymesPredicted intracellular proteinsPredicted secreted proteins
Protein Function (6)
- Predicted intracellular proteins
- Peptidases:Serine-type peptidases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
PRSS6SCCE
Gene Description
Kallikrein related peptidase 7
Chromosome
19
Position
50976468-50984099
Supporting publications (n)
17
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdrenal medulla cells
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- Peptidases:Serine-type peptidases
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- ENZYME proteins:Hydrolases
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Reactome (5)
- R-hsa-1474228 degradation of the extracellular matrix
- R-hsa-9734767 developmental cell lineages
- R-hsa-9734779 developmental cell lineages of the integumentary system
- R-hsa-9725554 differentiation of keratinocytes in interfollicular epidermis in mammalian skin
- R-hsa-1474244 extracellular matrix organization
Mediation Categories
Immune mediation
Relations & Evidence24
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | OmniPath | Yes | ||||
| secreted_peptidase | secreted_peptidase | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes | ||||
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| ligand | ligand | CellChatDB | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes | |||
| receptor | receptor | scConnect | Yes | Yes | |||
| kallikrein | extracellular_peptidase | HGNC | Yes |
Page 2 of 2Previous
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
253
Mass
27,525
Sequence
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Long; IsoId=P49862-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P49862-2; Sequence=VSP_013581
Alternative Sequence
1..72; Missing (in isoform 2)
3D Structural Models
Turn
106..108
Helix
69..71; 173..180; 181..183; 238..240; 242..251
Beta Strand
44..49; 52..61; 64..67; 76..81; 90..95; 97..100; 114..117; 125..127; 143..150; 152..156; 164..171; 188..192; 208..211; 214..221; 224..226; 233..237
3D Structure
X-ray crystallography (12)
Domain & Motif Annotations
Domain (FT)
30..250; Peptidase S1
Protein Families (2)
- Peptidase S1 family
- Kallikrein subfamily
Sequence Similarities
Belongs to the peptidase S1 family. Kallikrein subfamily.
Clinical Relevance
Supporting Publications17
| PMID | Title | Related sentences |
|---|---|---|
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39409015 | SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |
| 39569406 | Proteomics of circulating extracellular vesicles reveals diverse clinical presentations of COVID-19 but fails to identify viral peptides. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |
| 39940923 | NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles. | No related sentences available |
Page 2 of 2Previous