Protein detail
GBG10
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Entry name GBG10 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 0 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
0
EVMP confidence score
0.47
Fluorescence & Localization
Tissue SpecifictestisCell SpecificDifferentiating spermatogonia
Function & Pathway
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
KEGG (20)
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
Page 1 of 2
Reactome (56)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
Page 1 of 6
Canonical Pathways (3)
- M5887 Naba basement membranes
- M176 Pid foxm1 pathway
- M53 Pid integrin3 pathway
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence7
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
68
Mass
7,205
Sequence
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
Domain & Motif Annotations
Protein Families
G protein gamma family
Sequence Similarities
Belongs to the G protein gamma family.
Clinical Relevance
Drugs (10)
Interaction Protein (4)
ENSG00000078369ENSG00000111664ENSG00000171360ENSG00000172354
Interaction Count
4
Interaction Dataset (3)
biogrid_opencell_bioplexbiogrid_bioplexintact_biogrid