Protein detail
BCAM
Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
Entry name BCAM | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 27 | Transmembrane count 1 | Protein classification Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
Protein Class (5)
Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Blood group antigen proteins
- CD markers
- Predicted intracellular proteins
Transmembrane
548..568; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD239LU
Gene Description
Basal cell adhesion molecule (Lutheran blood group)
Chromosome
19
Position
44809071-44821421
Supporting publications (n)
27
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificLoop of henle epithelial cellsSingle-Nuclei Brain Specificlower rhombic lip
Function & Pathway
Protein Function (3)
- Blood group antigen proteins
- CD markers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence58
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| BCAM | CSNK2A1 | P68400 | S | 598 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| BCAM | PRKACA | P17612 | S | 621 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| BCAM | GSK3B | P49841 | S | 596 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (52)
52 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KAPCA | P17612 | BCAM | P50895 | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:15975931PhosphoSite:31413112 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
628
Mass
67,405
Sequence
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
3D Structural Models
Helix
117..119; 130..132; 228..232; 244..246
Beta Strand
34..36; 39..44; 49..51; 54..57; 60..69; 77..84; 87..92; 110..114; 121..128; 134..145; 151..154; 167..179; 182..187; 190..192; 200..210; 216..224; 234..242; 248..252
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
609..628; Gly residues
Domain (FT)
32..142; Ig-like V-type 1; 147..257; Ig-like V-type 2; 274..355; Ig-like C2-type 1; 363..441; Ig-like C2-type 2; 448..541; Ig-like C2-type 3
Region
309..312; Interaction with laminin alpha5; 579..628; Disordered
Clinical Relevance
Antibody
Supporting Publications27
| PMID | Title | Related sentences |
|---|---|---|
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No related sentences available |
| 31941606 | The role of actinin-4 (ACTN4) in exosomes as a potential novel therapeutic target in castration-resistant prostate cancer. | No related sentences available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 32284825 | Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. | No related sentences available |
| 33035814 | Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells. | No related sentences available |
| 34623918 | Metabolic responsiveness to training depends on insulin sensitivity and protein content of exosomes in insulin-resistant males. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 36612172 | Extracellular Vesicle Membrane Protein Profiling and Targeted Mass Spectrometry Unveil CD59 and Tetraspanin 9 as Novel Plasma Biomarkers for Detection of Colorectal Cancer. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |