Protein detail
BCAM
Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
Entry name BCAM | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 27 | Transmembrane count 1 | Protein classification Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
Protein Class (5)
Blood group antigen proteinsCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Blood group antigen proteins
- CD markers
- Predicted intracellular proteins
Transmembrane
548..568; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD239LU
Gene Description
Basal cell adhesion molecule (Lutheran blood group)
Chromosome
19
Position
44809071-44821421
Supporting publications (n)
27
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificLoop of henle epithelial cellsSingle-Nuclei Brain Specificlower rhombic lip
Function & Pathway
Protein Function (3)
- Blood group antigen proteins
- CD markers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence58
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| BCAM | CSNK2A1 | P68400 | S | 598 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| BCAM | PRKACA | P17612 | S | 621 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| BCAM | GSK3B | P49841 | S | 596 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (52)
52 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | connectomeDB2020 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | talklr | Yes | Yes | |||
| receptor | receptor | connectomeDB2020 | Yes | Yes | |||
| receptor | receptor | iTALK | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| receptor | receptor | EMBRACE | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes | ||||
| transmembrane_phobius | transmembrane_predicted | Almen2009 | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KAPCA | P17612 | BCAM | P50895 | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:15975931PhosphoSite:31413112 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
628
Mass
67,405
Sequence
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC
3D Structural Models
Helix
117..119; 130..132; 228..232; 244..246
Beta Strand
34..36; 39..44; 49..51; 54..57; 60..69; 77..84; 87..92; 110..114; 121..128; 134..145; 151..154; 167..179; 182..187; 190..192; 200..210; 216..224; 234..242; 248..252
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
609..628; Gly residues
Domain (FT)
32..142; Ig-like V-type 1; 147..257; Ig-like V-type 2; 274..355; Ig-like C2-type 1; 363..441; Ig-like C2-type 2; 448..541; Ig-like C2-type 3
Region
309..312; Interaction with laminin alpha5; 579..628; Disordered
Clinical Relevance
Antibody
Supporting Publications27
| PMID | Title | Related sentences |
|---|---|---|
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39409015 | SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |
| 39940641 | Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients. | No related sentences available |
| 40563475 | Unraveling the Multi-Omic Landscape of Extracellular Vesicles in Human Seminal Plasma. | No related sentences available |
Page 3 of 3Previous