Protein detail
P2RX1
P2X purinoceptor 1 (P2X1) (ATP receptor) (Purinergic receptor)
Entry name P2RX1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 2 | Transmembrane count 2 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
P2X purinoceptor 1 (P2X1) (ATP receptor) (Purinergic receptor)
Transmembrane
29..50; Helical; Name=1; 339..358; Helical; Name=2
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.40
Fluorescence & Localization
Function & Pathway
Cellular Component (9)
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0030667 secretory granule membrane
- GO:0032991 protein-containing complex
- GO:0035579 specific granule membrane
- GO:0045121 membrane raft
- GO:0045211 postsynaptic membrane
- GO:0048787 presynaptic active zone membrane
- GO:0098978 glutamatergic synapse
Molecular Function (9)
- GO:0001614 purinergic nucleotide receptor activity
- GO:0004931 extracellularly ATP-gated monoatomic cation channel activity
- GO:0005261 monoatomic cation channel activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0042802 identical protein binding
- GO:0043924 suramin binding
- GO:0044877 protein-containing complex binding
- GO:0099604 ligand-gated calcium channel activity
Biological Process (3)
KEGG (4)
Reactome (6)
Mediation Categories (4)
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence37
Ligand-Receptor Signaling (34)
34 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ion_channel | ion_channel | DGIdb | Yes | ||||
| ion_channel | ion_channel | Almen2009 | Yes | ||||
| atp_gated | ion_channel | Almen2009 | Yes | ||||
| ligand_gated | ion_channel | Almen2009 | Yes | ||||
| atp_gated | ion_channel | Surfaceome | Yes | ||||
| ligand_gated | ion_channel | Surfaceome | Yes | ||||
| transporter | transporter | OmniPath | Yes | ||||
| ion_channel | ion_channel | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Protein Organic Solvent Precipitation | Mass spectrometryR Sequencing | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
399
Mass
44,980
Sequence
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
3D Structural Models
3D Structure
Electron microscopy (7)
Domain & Motif Annotations
Domain (CC)
The N-terminal 20 to 23 and 27 to 29 residues seem to play a role in the cholesterol-dependent gating of this receptor.
Region
331..338; Pore-forming motif
Protein Families
P2X receptor family
Sequence Similarities
Belongs to the P2X receptor family.
Clinical Relevance
Drugs
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |