Protein detail
UB2D1
Ubiquitin-conjugating enzyme E2 D1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D1) (Stimulator of Fe transport) (SFT) (UBC4/5 homolog) (UbcH5) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2(17)KB 1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (Ubiquitin-protein ligase D1)
Entry name UB2D1 | UniProt ID | EVMP score 0.38 |
Frequency 2 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Ubiquitin-conjugating enzyme E2 D1 (EC 2.3.2.23) ((E3-independent) E2 ubiquitin-conjugating enzyme D1) (EC 2.3.2.24) (E2 ubiquitin-conjugating enzyme D1) (Stimulator of Fe transport) (SFT) (UBC4/5 homolog) (UbcH5) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2(17)KB 1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (Ubiquitin-protein ligase D1)
Protein Class
EnzymesMetabolic proteinsPredicted intracellular proteins
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
E2(17)KB1SFTUBC4/5UBCH5UbcH5A
Gene Description
Ubiquitin conjugating enzyme E2 D1
Chromosome
10
Position
58334979-58370751
Frequency
2
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificB-cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-9687136 aberrant regulation of mitotic exit in cancer due to rb1 defects
- R-hsa-176814 activation of apc c and apc c cdc20 mediated degradation of mitotic proteins
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-179409 apc cdc20 mediated degradation of nek2a
- R-hsa-174048 apc c cdc20 mediated degradation of cyclin b
- R-hsa-174178 apc c cdh1 mediated degradation of cdc20 and other apc c cdh1 targeted proteins in late mitosis early g1
- R-hsa-174143 apc c mediated degradation of cell cycle proteins
- R-hsa-69017 cdk mediated phosphorylation and removal of cdc6
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1234174 cellular response to hypoxia
- R-hsa-2559583 cellular senescence
- R-hsa-1640170 cell cycle
- R-hsa-69620 cell cycle checkpoints
- R-hsa-69278 cell cycle mitotic
- R-hsa-9909396 circadian clock
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-5607764 clec7a dectin 1 signaling
- R-hsa-176407 conversion from apc c cdc20 to apc c cdh1 in late anaphase
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-168928 ddx58 ifih1 mediated induction of interferon alpha beta
- R-hsa-73887 death receptor signaling
- R-hsa-9932298 degradation of cry and per proteins
- R-hsa-5688426 deubiquitination
- R-hsa-9675126 diseases of mitotic cell cycle
- R-hsa-69306 dna replication
- R-hsa-69002 dna replication pre initiation
- R-hsa-2173795 downregulation of smad2 3 smad4 transcriptional activity
- R-hsa-202424 downstream tcr signaling
- R-hsa-8866654 e3 ubiquitin ligases ubiquitinate target proteins
- R-hsa-2871837 fceri mediated nf kb activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-937041 ikk complex recruitment mediated by rip1
- R-hsa-9705462 inactivation of csf3 g csf signaling
- R-hsa-141405 inhibition of the proteolytic activity of apc c required for the onset of anaphase by mitotic spindle checkpoint components
- R-hsa-168249 innate immune system
- R-hsa-2555396 mitotic metaphase and anaphase
- R-hsa-69618 mitotic spindle checkpoint
- R-hsa-166166 myd88 independent tlr4 cascade
- R-hsa-68886 m phase
- R-hsa-8951664 neddylation
- R-hsa-936440 negative regulators of ddx58 ifih1 signaling
- R-hsa-5689896 ovarian tumor domain proteases
- R-hsa-9033241 peroxisomal protein import
- R-hsa-176412 phosphorylation of the apc c
- R-hsa-597592 post translational protein modification
- R-hsa-9609507 protein localization
- R-hsa-8852135 protein ubiquitination
- R-hsa-9948299 ribosome associated quality control
- R-hsa-9954709 ribosome quality control rqc complex extracts and degrades nascent peptide
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-2559582 senescence associated secretory phenotype sasp
- R-hsa-2467813 separation of sister chromatids
- R-hsa-201451 signaling by bmp
- R-hsa-9674555 signaling by csf3 g csf
- R-hsa-9006936 signaling by tgfb family members
- R-hsa-170834 signaling by tgf beta receptor complex
- R-hsa-69052 switching of origins to a post replicative state
- R-hsa-8866652 synthesis of active ubiquitin roles of e1 and e2 enzymes
- R-hsa-69239 synthesis of dna
- R-hsa-69242 s phase
- R-hsa-202403 tcr signaling
- R-hsa-168927 ticam1 rip1 mediated ikk complex recruitment
- R-hsa-75893 tnf signaling
- R-hsa-168898 toll like receptor cascades
- R-hsa-2173793 transcriptional activity of smad2 smad3 smad4 heterotrimer
- R-hsa-8853884 transcriptional regulation by ventx
- R-hsa-72766 translation
Canonical Pathways
- M44 Pid hif2pathway
- M255 Pid hif1 tfpathway
Mediation Categories
Clinical-translation mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
18 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SMUF2 | Q9HAU4 | UB2D1 | P51668 | Yes | Yes | No | HINTSIGNOR | HINT:24709419HINT:20858899HINT:32669362SIGNOR:24709419HINT:25723849 |
| UB2D1 | P51668 | ZSWM2 | Q8NEG5 | Yes | Yes | No | SIGNOR | SIGNOR:16522193 |
| PEX12 | O00623 | UB2D1 | P51668 | Yes | Yes | No | SIGNOR | SIGNOR:19687296 |
| COMPLEX:P22314_P62979 | UB2D1 | P51668 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P22314_P62987 | UB2D1 | P51668 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG47_P22314 | UB2D1 | P51668 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG48_P22314 | UB2D1 | P51668 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| UB2D1 | P51668 | COMPLEX:Q5XPI4_Q9BSL1 | Yes | Yes | No | SIGNOR | SIGNOR:15531880 |
Page 2 of 2Previous
Protein Complex Composition
12 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Ub:E2 | UBBUBE2D1 | P0CG47P51668 | 1:1 | SIGNORPDB | SIGNOR:SIGNOR-C497PDB:5tut | |
| Ub:E2 | UBCUBE2D1 | P0CG48P51668 | 2:2 | SIGNORPDB | PDB:3ptfSIGNOR:SIGNOR-C497 | |
| Ub:E2 | RPS27AUBE2D1 | P51668P62979 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBA52UBE2D1 | P51668P62987 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| ATP6V1FEIF2AK2UBE2D1UBR5WDR43 | O95071P19525P51668Q15061Q16864 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_445 | ||
| TNFAIP3UBCUBE2D1 | P0CG48P21580P51668 | 2:2:2 | PDB | PDB:3oj4 | ||
| ABRAXAS2BABAM1BABAM2BRCC3COPS5UBCUBE2D1USP7 | P0CG48P46736P51668Q15018Q92905Q93009Q9NWV8Q9NXR7 | 1:1:1:1:1:1:1:1 | CompleatCFinder | Compleat:HC6225 | ||
| TRIM2UBCUBE2D1 | P0CG48P51668Q9C040 | 4:4:4 | PDB | PDB:7zj3 | ||
| AKR1A1MPSTUBE2D1 | P14550P25325P51668 | 0:0:0 | hu.MAP | |||
| UBE2D1 | P51668 | 2 | PDB | PDB:2c4p |
Page 1 of 2Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | R SequencingMass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
147
Mass
16,602
Sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
3D Structural Models
Turn
44..47; 58..61; 90..92
Helix
1..15; 87..89; 99..111; 121..129; 131..146
Beta Strand
21..26; 29..38; 41..43; 49..55; 66..69; 115..117
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
1..147; UBC core
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Clinical Relevance
Drugs
Antibody
Interaction Protein
ENSG00000013561ENSG00000022840ENSG00000070423ENSG00000072609ENSG00000075975ENSG00000091073ENSG00000101871ENSG00000101966ENSG00000110171ENSG00000121481ENSG00000123091ENSG00000124226ENSG00000138942ENSG00000146755ENSG00000157450ENSG00000159461ENSG00000163481ENSG00000165280ENSG00000165886ENSG00000167770ENSG00000168411ENSG00000168894ENSG00000171206ENSG00000175104ENSG00000178498ENSG00000179455ENSG00000180537ENSG00000186187ENSG00000197579ENSG00000198919ENSG00000204227ENSG00000204308ENSG00000204599ENSG00000265491
Interaction Count
34
Interaction Dataset
intact_biogrid