Protein detail
CCR5
C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (CHEMR13) (HIV-1 fusion coreceptor) (CD antigen CD195)
Protein symbol CCR5 | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count 7 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
C-C chemokine receptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (CHEMR13) (HIV-1 fusion coreceptor) (CD antigen CD195)
Protein Function
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Endocrine and metabolic diseases:Diabetes
- CD markers
- G-protein coupled receptors:GPCRs excl olfactory receptors
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Transmembrane
31..58; Helical; Name=1; 69..89; Helical; Name=2; 103..124; Helical; Name=3; 142..166; Helical; Name=4; 199..218; Helical; Name=5; 236..260; Helical; Name=6; 278..301; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
EVMP Score
0.38
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Endocrine and metabolic diseases:Diabetes
- CD markers
- G-protein coupled receptors:GPCRs excl olfactory receptors
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component
Molecular Function
- GO:0001618 virus receptor activity
- GO:0003779 actin binding
- GO:0004435 phosphatidylinositol phospholipase C activity
- GO:0004950 chemokine receptor activity
- GO:0005515 protein binding
- GO:0015026 coreceptor activity
- GO:0016493 C-C chemokine receptor activity
- GO:0019957 C-C chemokine binding
- GO:0042802 identical protein binding
- GO:0071791 chemokine (C-C motif) ligand 5 binding
KEGG
- hsa03250 Viral life cycle - HIV-1
- KEGG:hsa03260 Virion - Human immunodeficiency virus
- KEGG:hsa04060 Cytokine-cytokine receptor interaction
- KEGG:hsa04061 Viral protein interaction with cytokine and cytokine receptor
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04144 Endocytosis
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05203 Viral carcinogenesis
Reactome
- R-hsa-380108 chemokine receptors bind chemokines
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-162594 early phase of hiv life cycle
- R-hsa-500792 gpcr ligand binding
- R-hsa-418594 g alpha i signalling events
- R-hsa-162906 hiv infection
- R-hsa-162587 hiv life cycle
- R-hsa-5663205 infectious disease
- R-hsa-6783783 interleukin 10 signaling
- R-hsa-375276 peptide ligand binding receptors
- R-hsa-372790 signaling by gpcr
- R-hsa-449147 signaling by interleukins
- R-hsa-9824446 viral infection pathways
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
33 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CCR5 | GRK3 | P35626 | S | 336 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:10085131SIGNOR:10085131KEA:12403770ProtMapper:10085131phosphoELM:10085131phosphoELM:12403770 |
| CCR5 | GRK3 | P35626 | S | 337 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:10085131KEA:10085131SIGNOR:10085131phosphoELM:10085131 |
| CCR5 | GRK3 | P35626 | S | 342 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:10085131KEA:10085131SIGNOR:10085131phosphoELM:10085131 |
| CCR5 | GRK3 | P35626 | S | 349 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:10085131KEA:10085131 |
| CCR5 | GRK2 | P25098 | S | 336 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPdbPTM | dbPTM:10085131 |
| CCR5 | GRK2 | P25098 | S | 337 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPdbPTM | dbPTM:10085131 |
| CCR5 | GRK2 | P25098 | S | 342 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPdbPTM | dbPTM:10085131 |
| CCR5 | GRK2 | P25098 | S | 349 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CCR5 | GRK4 | P32298 | S | 336 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CCR5 | GRK4 | P32298 | S | 337 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP |
Page 1 of 4Next
Ligand-Receptor Signaling
61 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | talklr | No | Yes | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
| receptor | receptor | scConnect | No | Yes | No | Yes | No |
| receptor | receptor | connectomeDB2020 | No | Yes | No | Yes | No |
| receptor | receptor | CellCall | No | Yes | No | Yes | No |
| receptor | receptor | iTALK | No | Yes | No | Yes | No |
| cytokine | receptor | iTALK | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| gpcr | receptor | GPCRdb | No | Yes | No | Yes | No |
| cc_chemokine | receptor | HGNC | No | Yes | No | Yes | No |
Regulatory Interaction Network
8 records.
Protein Complex Composition
Isolation & Detection Technology
Sequence, Structure & Domains
Sequences
Length
352
Mass
40,524
Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
3D Structural Models
Turn
20..22; 58..61; 133..135; 260..265
Helix
10..13; 14..17; 23..57; 64..91; 97..131; 136..139; 142..165; 184..186; 187..202; 204..221; 227..259; 269..288; 289..291; 292..299; 302..313
Beta Strand
167..172; 175..180; 341..344
3D Structure
Electron microscopy (6); NMR spectroscopy (5); X-ray crystallography (10)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases
Biomarker
Phase 2; Phase 3; Investigative; Approved; Phase 2a; Discontinued in Phase 1; Phase 1; Terminated
Drugs
Interaction Protein
ENSG00000271503
Interaction Count
1
Interaction Dataset
intact_biogrid