Protein detail
CCR9
C-C chemokine receptor type 9 (C-C CKR-9) (CC-CKR-9) (CCR-9) (G-protein coupled receptor 28) (GPR-9-6) (CD antigen CDw199)
Entry name CCR9 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification CD markersG-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
C-C chemokine receptor type 9 (C-C CKR-9) (CC-CKR-9) (CCR-9) (G-protein coupled receptor 28) (GPR-9-6) (CD antigen CDw199)
Protein Class (4)
CD markersG-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (4)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- CD markers
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
49..74; Helical; Name=1; 86..109; Helical; Name=2; 121..150; Helical; Name=3; 160..185; Helical; Name=4; 209..243; Helical; Name=5; 249..283; Helical; Name=6; 291..321; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CDw199GPR-9-6GPR28
Gene Description
C-C motif chemokine receptor 9
Chromosome
3
Position
45884425-45903174
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Function & Pathway
Protein Function (4)
- G-protein coupled receptors:Chemokines and chemotactic factors receptors
- CD markers
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
KEGG (4)
Reactome (6)
Canonical Pathways (3)
- M50 Pid ptp1b pathway
- M255 Pid hif1 tfpathway
- M5883 Naba secreted factors
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence69
Ligand-Receptor Signaling (66)
66 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| chemokine_interleukin_8_7tm_a | receptor | HPMR | Yes | Yes | |||
| rhodopsin | receptor | Surfaceome | Yes | Yes | |||
| gpcr | receptor | Surfaceome | Yes | Yes | |||
| class_a_rhodopsin | receptor | GPCRdb | Yes | Yes | |||
| class_a_rhodopsin_protein | receptor | GPCRdb | Yes | Yes | |||
| chemokine | receptor | ICELLNET | Yes | Yes | |||
| class_a_rhodopsin_protein_chemokine | receptor | GPCRdb | Yes | Yes | |||
| chemokine_cc | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | HPMR | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CCL25 | O15444 | CCR9 | P51686 | Yes | Yes | iTALKKirouac2010Guide2Pharma_LRdbICELLNETSIGNORCellPhoneDB_CellinkerDIPHPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrscConnectHPRDRamilowski2015_Baccin2019DLRP_talklrGuide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | ICELLNET:22633458HPRD:10229797connectomeDB2020:10498628connectomeDB2020:10229797Baccin2019:11159507DIP:10229797Baccin2019:10498628DIP:10498628HPMR:11159507SIGNOR:11159507CellTalkDB:10699158HPRD:10498628Cellinker:11159507LRdb:10699158Baccin2019:10229797connectomeDB2020:11159507 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | ELISA | 1 | 40784529 |
Sequence, Structure & Domains
Sequences
Length
369
Mass
42,016
Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=CCR9A; IsoId=P51686-1; Sequence=Displayed; Name=2; Synonyms=CCR9B; IsoId=P51686-2; Sequence=VSP_020286
Alternative Sequence
1..12; Missing (in isoform 2)
3D Structural Models
Helix
33..37; 45..75; 82..106; 117..148; 151..154; 155..157; 158..179; 181..185; 209..222; 224..243; 249..252; 254..282; 289..307; 308..311; 313..320; 324..341
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Related Diseases (3)
Biomarker
Phase 3; Phase 1
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |