Protein detail

CLCN2

Chloride channel protein 2 (ClC-2)

Entry name CLCN2	UniProt ID P51788	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 10	Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Chloride channel protein 2 (ClC-2)

Protein Class (6)

Disease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (4)

Human disease related genes:Nervous system diseases:Epilepsy
Disease related genes
FDA approved drug targets:Small molecule drugs
Transporters:Electrochemical Potential-driven transporters

Transmembrane

88..121; Helical; 130..155; Helical; 180..198; Helical; 205..223; Helical; 275..295; Helical; 321..349; Helical; 358..377; Helical; 429..449; Helical; 457..480; Helical; 531..548; Helical

Transmembrane Count

Ensembl

ENSG00000114859

Entrez Gene Symbol

CLCN2

Gene Synonym (3)

ClC-2CLC2EJM6

Gene Description

Chloride voltage-gated channel 2

Chromosome

Position

184346185-184361650

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization5

Tissue Specificheart muscleCell SpecificChoroid plexus epithelial cellsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway8

Protein Function (4)

Human disease related genes:Nervous system diseases:Epilepsy
Disease related genes
FDA approved drug targets:Small molecule drugs
Transporters:Electrochemical Potential-driven transporters

Cellular Component (9)

Molecular Function (4)

Biological Process (3)

KEGG

hsa04978 Mineral absorption

Reactome (3)

Canonical Pathways (3)

M5880 Naba ecm affiliated
M5885 Naba matrisome associated
M5889 Naba matrisome

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence23

Ligand-Receptor Signaling (21)

21 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane	transmembrane	TopDB	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
peripheral	peripheral	UniProt_topology	No	No	No	No	No
peripheral	peripheral	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
basolateral_cell_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
receptor	receptor	scConnect	No	Yes	No	No	No

Page 2 of 3Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CLCN2	P51788	2	PDB	PDB:8ta4PDB:8ta3PDB:8gquPDB:7xjaPDB:8ta6PDB:8ta2PDB:8ta5PDB:7xf5

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	4	36512648 37452413 37475710 37993261

Sequence, Structure & Domains15

Sequences

Length

898

Mass

98,535

Sequence

MAAAAAEEGMEPRALQYEQTLMYGRYTQDLGAFAKEEAARIRLGGPEPWKGPPSSRAAPELLEYGRSRCARCRVCSVRCHKFLVSRVGEDWIFLVLLGLLMALVSWVMDYAIAACLQAQQWMSRGLNTSILLQYLAWVTYPVVLITFSAGFTQILAPQAVGSGIPEMKTILRGVVLKEYLTLKTFIAKVIGLTCALGSGMPLGKEGPFVHIASMCAALLSKFLSLFGGIYENESRNTEMLAAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFFAATFSAFIFRVLAVWNRDEETITALFKTRFRLDFPFDLQELPAFAVIGIASGFGGALFVYLNRKIVQVMRKQKTINRFLMRKRLLFPALVTLLISTLTFPPGFGQFMAGQLSQKETLVTLFDNRTWVRQGLVEELEPPSTSQAWNPPRANVFLTLVIFILMKFWMSALATTIPVPCGAFMPVFVIGAAFGRLVGESMAAWFPDGIHTDSSTYRIVPGGYAVVGAAALAGAVTHTVSTAVIVFELTGQIAHILPVMIAVILANAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHVALSCTFRDLRLALHRTKGRMLALVESPESMILLGSIERSQVVALLGAQLSPARRRQHMQERRATQTSPLSDQEGPPTPEASVCFQVNTEDSAFPAARGETHKPLKPALKRGPSVTRNLGESPTGSAESAGIALRSLFCGSPPPEAASEKLESCEKRKLKRVRISLASDADLEGEMSPEEILEWEEQQLDEPVNFSDCKIDPAPFQLVERTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P51788-1; Sequence=Displayed; Name=2; IsoId=P51788-2; Sequence=VSP_007831, VSP_007832, VSP_036455; Name=3; IsoId=P51788-3; Sequence=VSP_036456; Name=4; IsoId=P51788-4; Sequence=VSP_045457; Name=5; IsoId=P51788-5; Sequence=VSP_045458

Alternative Sequence

1..359; Missing (in isoform 2); 74..117; Missing (in isoform 4); 443..485; FWMSALATTIPVPCGAFMPVFVIGAAFGRLVGESMAAWFPDGI -> HLGVWWVKAWLPGSQMEFIRTAAPTGLCLGATLWSGQLRWQER (in isoform 2); 466..482; Missing (in isoform 3); 486..898; Missing (in isoform 2); 806..834; Missing (in isoform 5)

3D Structural Models

Turn

126..128; 177..180; 228..230; 380..382; 388..390; 407..410; 618..620

Helix

89..125; 130..155; 157..159; 164..171; 182..197; 205..222; 235..252; 257..266; 272..295; 318..320; 321..351; 353..361; 362..364; 365..378; 383..387; 393..400; 422..424; 431..449; 459..480; 496..512; 517..525; 531..546; 552..559; 573..577; 580..583; 597..605; 629..640; 775..778; 803..812; 832..840

Beta Strand

15..18; 21..23; 25..27; 268..271; 298..302; 312..314; 414..416; 427..429; 452..455; 485..488; 490..492; 590..592; 609..616; 622..628; 816..831

3D Structure

Electron microscopy (8)

Domain & Motif Annotations

Compositional Bias

705..717; Polar residues

Motif

161..165; Selectivity filter part_1; 203..207; Selectivity filter part_2; 457..461; Selectivity filter part_3; 812..813; Basolateral membrane sorting

Domain (FT)

584..642; CBS 1; 790..850; CBS 2

Region

16..34; Essential for channel gating by both voltage and cell volume; 36..49; Modulates channel gating by both voltage and cell volume; 643..672; Disordered; 686..717; Disordered; 856..898; Disordered

Protein Families (2)

Chloride channel (TC 2.A.49) family
ClC-2/CLCN2 subfamily

Sequence Similarities

Belongs to the chloride channel (TC 2.A.49) family. ClC-2/CLCN2 subfamily.

Clinical Relevance4

Disease Involvement (3)

Disease variantEpilepsyFDA approved drug targets

Drug Targets

FDA approved drug targets

Drugs (4)

CUSTIRSEN SODIUM LUBIPROSTONE COBIPROSTONE NULL

Antibody (3)

CAB009397 HPA014545 HPA024108

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available