Protein detail
CLCN2
Chloride channel protein 2 (ClC-2)
Entry name CLCN2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 10 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Chloride channel protein 2 (ClC-2)
Protein Class (6)
Disease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- Human disease related genes:Nervous system diseases:Epilepsy
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Transporters:Electrochemical Potential-driven transporters
Transmembrane
88..121; Helical; 130..155; Helical; 180..198; Helical; 205..223; Helical; 275..295; Helical; 321..349; Helical; 358..377; Helical; 429..449; Helical; 457..480; Helical; 531..548; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ClC-2CLC2EJM6
Gene Description
Chloride voltage-gated channel 2
Chromosome
3
Position
184346185-184361650
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificheart muscleCell SpecificChoroid plexus epithelial cellsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (4)
- Human disease related genes:Nervous system diseases:Epilepsy
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Transporters:Electrochemical Potential-driven transporters
Cellular Component (9)
Molecular Function (4)
Biological Process (3)
Reactome (3)
Canonical Pathways (3)
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence23
Ligand-Receptor Signaling (21)
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| peripheral | peripheral | UniProt_topology | |||||
| peripheral | peripheral | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| basolateral_cell_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
898
Mass
98,535
Sequence
MAAAAAEEGMEPRALQYEQTLMYGRYTQDLGAFAKEEAARIRLGGPEPWKGPPSSRAAPELLEYGRSRCARCRVCSVRCHKFLVSRVGEDWIFLVLLGLLMALVSWVMDYAIAACLQAQQWMSRGLNTSILLQYLAWVTYPVVLITFSAGFTQILAPQAVGSGIPEMKTILRGVVLKEYLTLKTFIAKVIGLTCALGSGMPLGKEGPFVHIASMCAALLSKFLSLFGGIYENESRNTEMLAAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFFAATFSAFIFRVLAVWNRDEETITALFKTRFRLDFPFDLQELPAFAVIGIASGFGGALFVYLNRKIVQVMRKQKTINRFLMRKRLLFPALVTLLISTLTFPPGFGQFMAGQLSQKETLVTLFDNRTWVRQGLVEELEPPSTSQAWNPPRANVFLTLVIFILMKFWMSALATTIPVPCGAFMPVFVIGAAFGRLVGESMAAWFPDGIHTDSSTYRIVPGGYAVVGAAALAGAVTHTVSTAVIVFELTGQIAHILPVMIAVILANAVAQSLQPSLYDSIIRIKKLPYLPELGWGRHQQYRVRVEDIMVRDVPHVALSCTFRDLRLALHRTKGRMLALVESPESMILLGSIERSQVVALLGAQLSPARRRQHMQERRATQTSPLSDQEGPPTPEASVCFQVNTEDSAFPAARGETHKPLKPALKRGPSVTRNLGESPTGSAESAGIALRSLFCGSPPPEAASEKLESCEKRKLKRVRISLASDADLEGEMSPEEILEWEEQQLDEPVNFSDCKIDPAPFQLVERTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=P51788-1; Sequence=Displayed; Name=2; IsoId=P51788-2; Sequence=VSP_007831, VSP_007832, VSP_036455; Name=3; IsoId=P51788-3; Sequence=VSP_036456; Name=4; IsoId=P51788-4; Sequence=VSP_045457; Name=5; IsoId=P51788-5; Sequence=VSP_045458
Alternative Sequence
1..359; Missing (in isoform 2); 74..117; Missing (in isoform 4); 443..485; FWMSALATTIPVPCGAFMPVFVIGAAFGRLVGESMAAWFPDGI -> HLGVWWVKAWLPGSQMEFIRTAAPTGLCLGATLWSGQLRWQER (in isoform 2); 466..482; Missing (in isoform 3); 486..898; Missing (in isoform 2); 806..834; Missing (in isoform 5)
3D Structural Models
Turn
126..128; 177..180; 228..230; 380..382; 388..390; 407..410; 618..620
Helix
89..125; 130..155; 157..159; 164..171; 182..197; 205..222; 235..252; 257..266; 272..295; 318..320; 321..351; 353..361; 362..364; 365..378; 383..387; 393..400; 422..424; 431..449; 459..480; 496..512; 517..525; 531..546; 552..559; 573..577; 580..583; 597..605; 629..640; 775..778; 803..812; 832..840
Beta Strand
15..18; 21..23; 25..27; 268..271; 298..302; 312..314; 414..416; 427..429; 452..455; 485..488; 490..492; 590..592; 609..616; 622..628; 816..831
3D Structure
Electron microscopy (8)
Domain & Motif Annotations
Compositional Bias
705..717; Polar residues
Motif
161..165; Selectivity filter part_1; 203..207; Selectivity filter part_2; 457..461; Selectivity filter part_3; 812..813; Basolateral membrane sorting
Domain (FT)
584..642; CBS 1; 790..850; CBS 2
Region
16..34; Essential for channel gating by both voltage and cell volume; 36..49; Modulates channel gating by both voltage and cell volume; 643..672; Disordered; 686..717; Disordered; 856..898; Disordered
Protein Families (2)
- Chloride channel (TC 2.A.49) family
- ClC-2/CLCN2 subfamily
Sequence Similarities
Belongs to the chloride channel (TC 2.A.49) family. ClC-2/CLCN2 subfamily.
Clinical Relevance
Disease Involvement (3)
Disease variantEpilepsyFDA approved drug targets
Related Diseases
Drug Targets
FDA approved drug targets
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |