Protein detail
GP143
G-protein coupled receptor 143 (Ocular albinism type 1 protein)
Entry name GP143 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
G-protein coupled receptor 143 (Ocular albinism type 1 protein)
Protein Class (6)
Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (6)
- Transporters
- Potential drug targets
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of amino acid metabolism
Transmembrane
29..49; Helical; Name=1; 79..99; Helical; Name=2; 125..145; Helical; Name=3; 150..170; Helical; Name=4; 192..212; Helical; Name=5; 249..269; Helical; Name=6; 293..313; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
OA1
Gene Description
G protein-coupled receptor 143
Chromosome
X
Position
9725346-9786297
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificCardiomyocytes
Function & Pathway
Protein Function (6)
- Transporters
- Potential drug targets
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of amino acid metabolism
Cellular Component (8)
Molecular Function (6)
Biological Process (3)
Reactome (8)
- R-hsa-375280 amine ligand binding receptors
- R-hsa-373076 class a 1 rhodopsin like receptors
- R-hsa-500792 gpcr ligand binding
- R-hsa-416476 g alpha q signalling events
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-9824585 regulation of mitf m dependent genes involved in pigmentation
- R-hsa-372790 signaling by gpcr
Mediation Categories (3)
Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence41
Ligand-Receptor Signaling (40)
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | Ramilowski_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | scConnect | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| gpcr | receptor | GPCRdb | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 4 of 4Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
404
Mass
43,878
Sequence
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Domain & Motif Annotations
Compositional Bias
355..366; Polar residues
Motif
222..231; lysosomal/melanosomal membrane localization signal; 329..330; lysosomal/melanosomal membrane localization signal
Domain (CC)
The cytoplasmic domain 3 and the C-terminus tail domain contain the lysosomal sorting signals and are necessary and sufficient for intracellular retention and delivery to lysosomal and melanosomal, respectively in melanocytic and non-melanocytic cells.
Region
221..238; Necessary for its G protein-activation ability and normal distribution of melanosomes; 338..404; Disordered
Protein Families
G-protein coupled receptor OA family
Sequence Similarities
Belongs to the G-protein coupled receptor OA family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |