EV MemProt Atlas

Basic Information11

Protein Names

Tyrosine-protein kinase JAK3 (EC 2.7.10.2) (Janus kinase 3) (JAK-3) (Leukocyte janus kinase) (L-JAK)

Protein Class (6)

Cancer-related genesDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPredicted intracellular proteins

Protein Function (8)

Predicted intracellular proteins
ENZYME proteins:Transferases
Human disease related genes:Immune system diseases:Primary immunodeficiency
Enzymes
Cancer-related genes
Kinases:Tyr protein kinases
Disease related genes
FDA approved drug targets:Small molecule drugs

Ensembl

ENSG00000105639

Entrez Gene Symbol

JAK3

Gene Synonym (5)

JAK-3JAK3_HUMANJAKLL-JAKLJAK

Gene Description

Janus kinase 3

Chromosome

19

Position

17824780-17848071

Supporting publications (n)

3

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue Specificfallopian tubeCell SpecificAstrocytesSingle-Nuclei Brain Specificependymal cellBlood Cell Specificbasophil

Function & Pathway8

Protein Function (8)

Predicted intracellular proteins
ENZYME proteins:Transferases
Human disease related genes:Immune system diseases:Primary immunodeficiency
Enzymes
Cancer-related genes
Kinases:Tyr protein kinases
Disease related genes
FDA approved drug targets:Small molecule drugs

Cellular Component (7)

Molecular Function (6)

Biological Process (3)

KEGG (15)

Page 1 of 2

Reactome (20)

Page 1 of 2

Canonical Pathways

M232 Pid ecadherin stabilization pathway

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationImmune mediationReceptor-signaling mediation

Relations & Evidence46

Enzyme-Mediated Modification (5)

5 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
JAK3	PTPN2	P17706	Y	980	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:11909529
JAK3	PTPN2	P17706	Y	981	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:11909529
JAK3	CDKL2	Q92772	Y	506	phosphorylation	RLIMS-P_ProtMapperProtMapper	ProtMapper:10889465
JAK3	IGF1R	P08069	Y	981	phosphorylation	KEA	KEA:17570479
JAK3	LCK	P06239	Y	981	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
receptor	receptor	scConnect	No	Yes	No	No	No

Regulatory Interaction Network (30)

30 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
IL4RA	P24394	JAK3	P52333	Yes	Yes	No	WangNetPathHPRDSignaLink3InnateDBSPIKE_LCSPIKE	NetPath:12207328 SPIKE:17312100 SignaLink3:7538655 HPRD:7538655 SPIKE_LC:12207328 SignaLink3:23331499 InnateDB:12207328 SPIKE_LC:17312100 SPIKE:12207328
SOCS3	O14543	JAK3	P52333	Yes	No	Yes	InnateDBHPRDWangSIGNOR	SIGNOR:21508344 HPRD:10373548 InnateDB:15385932
JAK1	P23458	JAK3	P52333	Yes	Yes	No	PhosphoPointSIGNORHPRDCui2007HINTSignaLink3BioGRIDInnateDBWang	HPRD:9553136 HINT:32001089 SignaLink3:10825200 BioGRID:12207328 HINT:12207328 SIGNOR:17259970 HPRD:12559972 SignaLink3:23331499 InnateDB:12207328
JAK3	P52333	JAK1	P23458	Yes	Yes	Yes	SPIKEHPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEAInnateDBHPRDCui2007Kinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEABioGRIDHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteSPIKE_LCHPRD-phos	PhosphoSite:12559972 KEA:15659558 HINT:12207328 HPRD:9553136 PhosphoSite:11909529 SPIKE_LC:10825200 InnateDB:12207328 PhosphoSite:20135364 ProtMapper:12559972 BioGRID:12207328 HPRD-phos:12559972 SIGNOR:17259970 SPIKE:10825200 HPRD-phos:19901323 SIGNOR:12559972 HINT:32001089 ProtMapper:19901323 phosphoELM:12559972 HPRD:12559972 KEA:12559972 PhosphoSite:11641425
JAK3	P52333	STAT3	P40763	Yes	Yes	No	WangKEGG-MEDICUSPhosphoPointSIGNORProtMapperHPRDSignaLink3InnateDBSPIKE_LCREACH_ProtMapperSPIKETCRcuration_SignaLink3	SignaLink3:18988627 SignaLink3:12934099 SignaLink3:23109003 HPRD:10037026 SignaLink3:11406370 SIGNOR:30029643 ProtMapper:31909200 SPIKE_LC:10825200 SPIKE:10825200 SignaLink3:10037026 SignaLink3:12495636 SignaLink3:23331499 InnateDB:12207328 SPIKE_LC:16189514
PTN6	P29350	JAK3	P52333	Yes	Yes	Yes	WangSIGNORHPRDSignaLink3SPIKE_LCSPIKE	SignaLink3:9520455 SignaLink3:18988627 HPRD:9520455 SPIKE:9520455 SPIKE_LC:9520455 SignaLink3:23331499 SIGNOR:11021818 SignaLink3:11021818
JAK3	P52333	STA5A	P42229	Yes	Yes	No	WangphosphoELM_MIMPPhosphoSite_MIMPKEGG-MEDICUSMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDHINTSignaLink3BioGRIDSIGNOR_ProtMapperSPIKEPhosphoSite_ProtMapperSPIKE_LC	ProtMapper:19088846 HINT:9047382 SPIKE_LC:19414780 SignaLink3:7777534 HPRD:10037026 SIGNOR:18250158 SPIKE:19414780 SIGNOR:19088846 SignaLink3:23331499 HINT:10037026 ProtMapper:18250158 HPRD:9047382 BioGRID:18250158 SPIKE_LC:16189514
JAK3	P52333	STAM1	Q92783	Yes	Yes	No	WangNetPathPhosphoPointHPRDSignaLink3SPIKE_LCSPIKE	SPIKE:16189514 NetPath:9133424 HPRD:10899310 SignaLink3:9133424 SignaLink3:23331499 SPIKE_LC:9133424 SPIKE:9133424 SPIKE_LC:16189514
IL2RG	P31785	JAK3	P52333	Yes	Yes	No	WangKEGG-MEDICUSNetPathSIGNORHPRDCui2007HINTSignaLink3InnateDBDIPSPIKE_LCSPIKE	InnateDB:7973657 SIGNOR:18445337 NetPath:10856136 SPIKE:16189514 SPIKE_LC:7973658 NetPath:15621723 NetPath:7973659 SPIKE_LC:16189514 NetPath:7973658 SignaLink3:7973659 SignaLink3:23331499 SPIKE:7973658 DIP:7973658 HPRD:7973658 InnateDB:10629052 HINT:7973657 HINT:10629052 SignaLink3:7973658
JAK3	P52333	FAK2	Q14289	Yes	Yes	No	WangNetPathPhosphoPointHPRDSignaLink3SPIKE_LCSPIKE	HPRD:9512511 SignaLink3:9512511 NetPath:9512511 SPIKE_LC:9512511 SignaLink3:23331499 SPIKE:9512511 SignaLink3:21071413

Page 1 of 3Next

Protein Complex Composition (4)

4 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster67	ALDH16A1 DERA INSL3 JAK1 JAK2 JAK3 NAA20 NAA25 TYK2 YJU2B	O60674 P13994 P23458 P29597 P51460 P52333 P61599 Q14CX7 Q8IZ83 Q9Y315	1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2854	22036573
	JAK3 PTPN1	P18031 P52333	1:1	PDB	PDB:8exm
	JAK1 JAK3	P23458 P52333	0:0	KEGG-MEDICUS
	JAK3	P52333	4	PDB	PDB:6aakPDB:6gl9PDB:4qpsPDB:6glaPDB:7apgPDB:5w86PDB:3zc6PDB:4v0gPDB:6glbPDB:4z16PDB:7uyvPDB:3zepPDB:7apfPDB:6hzv

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
PRotein Organic Solvent Precipitation；Differential Ultracentrifugation	Mass spectrometry	1	32384937

Sequence, Structure & Domains14

Sequences

Length

1,124

Mass

125,099

Sequence

MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKASGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGLRKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIMDLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFCKEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNPLGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPKEKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRHEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=2; Synonyms=JAK3S, Spleen-JAK3; IsoId=P52333-1; Sequence=Displayed; Name=1; Synonyms=JAK3B, Breast-JAK3; IsoId=P52333-2; Sequence=VSP_004989; Name=3; IsoId=P52333-4; Sequence=VSP_054165, VSP_054166

Alternative Sequence

597..619; TMVQEFVHLGAIDMYLRKRGHLV -> ESPPPTHPTPASPKSRLFFPPLF (in isoform 3); 620..1124; Missing (in isoform 3); 1071..1124; HELMKLCWAPSPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS -> SAAGLASVSQSVDWAGVSGKPAGA (in isoform 1)

3D Structural Models

Turn

1022..1024

Helix

819..821; 862..877; 910..917; 918..920; 923..942; 952..954; 968..970; 991..993; 996..1001; 1006..1021; 1026..1028; 1030..1037; 1046..1055; 1068..1077; 1082..1084; 1088..1102

Beta Strand

816..818; 822..830; 832..841; 845..847; 849..859; 886..891; 893..896; 898..903; 955..959; 962..965; 979..982; 1003..1005; 1042..1044

3D Structure

X-ray crystallography (42)

Domain & Motif Annotations

Domain (CC)

Possesses two phosphotransferase domains. The second one probably contains the catalytic domain (By similarity), while the presence of slight differences suggest a different role for domain 1..

Domain (FT)

24..356; FERM; 375..475; SH2; atypical; 521..781; Protein kinase 1; 822..1111; Protein kinase 2

Region

1..223; Interaction with cytokine/interferon/growth hormone receptors

Protein Families (3)

Protein kinase superfamily
Tyr protein kinase family
JAK subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.

Clinical Relevance7

Disease Involvement (4)

Cancer-related genesDisease variantFDA approved drug targetsSCID

Drug Targets

FDA approved drug targets

Antibody

HPA070314

Interaction Protein (2)

ENSG00000102316ENSG00000187109

Interaction Count

2

Interaction Dataset

intact_biogrid

Supporting Publications3

PMID	Title	Abstract
18802920	Secretion of active membrane type 1 matrix metalloproteinase (MMP-14) into extracellular space in microvesicular exosomes.	The exosomes were able to activate pro-MMP-2 and degrade type 1 collagen and gelatin, suggesting that the exosomal MT1-MMP was functionally active. The isolated exosomes were identified by their vesicular structure in electron microscopy and by exosomal marker proteins CD9 and tumor susceptibility gene (TSG101). The targeting of MT1-MMP in exosomes represents a novel mechanism for cancer cells to secrete membrane type metalloproteolytic activity into the extracellular space. Using cultured human fibrosarcoma (HT-1080) and melanoma (G361) cells we provide evidence that both the full-length 60 kDa and the proteolytically processed 43 kDa forms of MT1-MMP are secreted in exosomes. We hypothesized that some of the endosomal MT1-MMP could be directed to exosomes for extracellular release.
38612385	Comparison of Extracellular Vesicles from Induced Pluripotent Stem Cell-Derived Brain Cells.	Of the 31 exosome surface markers analyzed, a subset of biomarkers were significantly enriched in astrocytes (CD29, CD44, and CD49e), microglia-like cells (CD44), and neural stem cells (SSEA4).
39166055	Dental pulp stem cells regenerate neural tissue in degenerative disorders and stroke rehabilitation: A scope systematic review.	DPSC-derived exosomes suppressed the expression of IL-6, IL-1β, TNF-α, and TGF, key mediators of nerve tissue inflammation.

Entry name JAK3	UniProt ID P52333	EVMP confidence score 0.50
Supporting publications (n) 3	Transmembrane count	Protein classification Cancer-related genesDisease related genesEnzymesFDA approved drug targetsHuman disease related genesPredicted intracellular proteins