Protein detail
AP2S1
AP-2 complex subunit sigma (Adaptor protein complex AP-2 subunit sigma) (Adaptor-related protein complex 2 subunit sigma) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (HA2 17 kDa subunit) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma2-adaptin)
Entry name AP2S1 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 0 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
AP-2 complex subunit sigma (Adaptor protein complex AP-2 subunit sigma) (Adaptor-related protein complex 2 subunit sigma) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (HA2 17 kDa subunit) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma2-adaptin)
Protein Function (5)
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Potential drug targets
- Disease related genes
Ensembl
Entrez Gene Symbol
Supporting publications (n)
0
EVMP confidence score
0.47
Fluorescence & Localization
Cell SpecificNeutrophils
Function & Pathway
Protein Function (5)
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Potential drug targets
- Disease related genes
Cellular Component (11)
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0030122 AP-2 adaptor complex
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0036020 endolysosome membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045334 clathrin-coated endocytic vesicle
- GO:0098793 presynapse
Page 1 of 2
Molecular Function (2)
Biological Process (3)
KEGG (5)
Reactome (41)
- R-hsa-1280218 adaptive immune system
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-8856825 cargo recognition for clathrin mediated endocytosis
- R-hsa-8856828 clathrin mediated endocytosis
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9839923 dengue virus infection
- R-hsa-3928665 eph ephrin mediated repulsion of cells
- R-hsa-2682334 eph ephrin signaling
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
Page 1 of 5
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence8
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
142
Mass
17,018
Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P53680-1; Sequence=Displayed; Name=2; IsoId=P53680-2; Sequence=VSP_017352
Alternative Sequence
52..89; Missing (in isoform 2)
3D Structural Models
Helix
25..39; 77..95; 102..105; 107..117; 128..140
Beta Strand
2..9; 14..19; 48..52; 55..62; 65..71
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
Adaptor complexes small subunit family
Sequence Similarities
Belongs to the adaptor complexes small subunit family.
Clinical Relevance
Interaction Protein (12)
ENSG00000006125ENSG00000017797ENSG00000085832ENSG00000103591ENSG00000115977ENSG00000127527ENSG00000128891ENSG00000138756ENSG00000157107ENSG00000157191ENSG00000161203ENSG00000205726
Interaction Count
12
Interaction Dataset (2)
biogrid_opencellintact_biogrid_opencell