Protein detail
AP2S1
AP-2 complex subunit sigma (Adaptor protein complex AP-2 subunit sigma) (Adaptor-related protein complex 2 subunit sigma) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (HA2 17 kDa subunit) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma2-adaptin)
Protein symbol AP2S1 | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count | Protein classification |
Basic Information
Protein Names
AP-2 complex subunit sigma (Adaptor protein complex AP-2 subunit sigma) (Adaptor-related protein complex 2 subunit sigma) (Clathrin assembly protein 2 sigma small chain) (Clathrin coat assembly protein AP17) (Clathrin coat-associated protein AP17) (HA2 17 kDa subunit) (Plasma membrane adaptor AP-2 17 kDa protein) (Sigma2-adaptin)
Protein Function
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Potential drug targets
- Disease related genes
Ensembl
Entrez Gene Symbol
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificNeutrophils
Function & Pathway
Protein Function
- Transporters
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Potential drug targets
- Disease related genes
Cellular Component
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0030122 AP-2 adaptor complex
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0036020 endolysosome membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045334 clathrin-coated endocytic vesicle
- GO:0098793 presynapse
- GO:0098794 postsynapse
Molecular Function
Biological Process
KEGG
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-8856825 cargo recognition for clathrin mediated endocytosis
- R-hsa-8856828 clathrin mediated endocytosis
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9839923 dengue virus infection
- R-hsa-3928665 eph ephrin mediated repulsion of cells
- R-hsa-2682334 eph ephrin signaling
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-5663205 infectious disease
- R-hsa-373760 l1cam interactions
- R-hsa-8964038 ldl clearance
- R-hsa-199991 membrane trafficking
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-167590 nef mediated cd4 down regulation
- R-hsa-182218 nef mediated cd8 down regulation
- R-hsa-164938 nef mediates down modulation of cell surface receptors by recruiting them to clathrin adapters
- R-hsa-9675108 nervous system development
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-4086400 pcp ce pathway
- R-hsa-174824 plasma lipoprotein assembly remodeling and clearance
- R-hsa-8964043 plasma lipoprotein clearance
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-437239 recycling pathway of l1
- R-hsa-177504 retrograde neurotrophin signalling
- R-hsa-9679506 sars cov infections
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-195721 signaling by wnt
- R-hsa-164952 the role of nef in hiv 1 replication and disease pathogenesis
- R-hsa-399719 trafficking of ampa receptors
- R-hsa-416993 trafficking of glur2 containing ampa receptors
- R-hsa-112315 transmission across chemical synapses
- R-hsa-382551 transport of small molecules
- R-hsa-5653656 vesicle mediated transport
- R-hsa-9824446 viral infection pathways
- R-hsa-8866427 vldlr internalisation and degradation
- R-hsa-5140745 wnt5a dependent internalization of fzd2 fzd5 and ror2
- R-hsa-5099900 wnt5a dependent internalization of fzd4
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
142
Mass
17,018
Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P53680-1; Sequence=Displayed; Name=2; IsoId=P53680-2; Sequence=VSP_017352
Alternative Sequence
52..89; Missing (in isoform 2)
3D Structural Models
Helix
25..39; 77..95; 102..105; 107..117; 128..140
Beta Strand
2..9; 14..19; 48..52; 55..62; 65..71
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Protein Families
Adaptor complexes small subunit family
Sequence Similarities
Belongs to the adaptor complexes small subunit family.
Clinical Relevance
Interaction Protein
ENSG00000006125ENSG00000017797ENSG00000085832ENSG00000103591ENSG00000115977ENSG00000127527ENSG00000128891ENSG00000138756ENSG00000157107ENSG00000157191ENSG00000161203ENSG00000205726
Interaction Count
12
Interaction Dataset
biogrid_opencellintact_biogrid_opencell