Protein detail
MOT1
Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1)
Entry name MOT1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 12 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1)
Protein Class (6)
Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Potential drug targets
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
Transmembrane
23..44; Helical; Name=1; 56..80; Helical; Name=2; 85..105; Helical; Name=3; 110..132; Helical; Name=4; 147..169; Helical; Name=5; 175..194; Helical; Name=6; 262..288; Helical; Name=7; 296..317; Helical; Name=8; 329..349; Helical; Name=9; 354..375; Helical; Name=10; 390..410; Helical; Name=11; 422..443; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MCTMCT1
Gene Description
Solute carrier family 16 member 1
Chromosome
1
Position
112911847-112957593
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Tissue SpecificintestineCell SpecificEnterocytesSecretome LocationIntracellular and membraneSecretome FunctionEnzyme
Function & Pathway7
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Potential drug targets
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
Cellular Component (11)
- GO:0005813 centrosome
- GO:0005886 plasma membrane
- GO:0009925 basal plasma membrane
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0030054 cell junction
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045202 synapse
Page 1 of 2
Molecular Function (9)
- GO:0005515 protein binding
- GO:0008028 monocarboxylic acid transmembrane transporter activity
- GO:0015129 lactate transmembrane transporter activity
- GO:0015130 mevalonate transmembrane transporter activity
- GO:0015141 succinate transmembrane transporter activity
- GO:0015650 lactate:proton symporter activity
- GO:0042802 identical protein binding
- GO:0046943 carboxylic acid transmembrane transporter activity
- GO:0097159 organic cyclic compound binding
Reactome (11)
- R-hsa-9749641 aspirin adme
- R-hsa-210991 basigin interactions
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-9748784 drug adme
- R-hsa-109582 hemostasis
- R-hsa-433692 proton coupled monocarboxylate transport
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-9955298 slc mediated transport of organic anions
- R-hsa-5619102 slc transporter disorders
Page 1 of 2
Canonical Pathways (2)
- M200 Pid era genomic pathway
- M145 Pid p53 downstream pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence38
Ligand-Receptor Signaling (35)
35 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | LOCATE | No | No | No | No | No |
| plasma_membrane | plasma_membrane | LOCATE | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
Protein Complex Composition (2)
Sequence, Structure & Domains13
Sequences
Length
500
Mass
53,944
Sequence
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAFLLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYAGFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYKYTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTDGGPKEEESPV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P53985-1; Sequence=Displayed; Name=2; IsoId=P53985-2; Sequence=VSP_056191
Alternative Sequence
411..500; RLNDMYGDYKYTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTDGGPKEEESPV -> IVYLPTNVGLLQNKHVRWEC (in isoform 2)
3D Structural Models
Turn
323..325; 420..422
Helix
18..39; 41..43; 44..51; 55..83; 86..103; 109..138; 143..171; 174..191; 255..258; 263..275; 279..290; 297..320; 326..328; 331..346; 347..349; 354..382; 387..398; 401..414; 423..448
Beta Strand
140..142; 351..353; 384..386; 416..419
3D Structure
Electron microscopy (6)
Domain & Motif Annotations
Compositional Bias
454..465; Basic and acidic residues; 482..500; Basic and acidic residues
Region
454..500; Disordered
Protein Families (2)
- Major facilitator superfamily
- Monocarboxylate porter (TC 2.A.1.13) family
Sequence Similarities
Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.
Clinical Relevance6
Disease Involvement
Disease variant
Interaction Protein (2)
ENSG00000170571ENSG00000172270
Interaction Count
2
Interaction Dataset
biogrid_opencell
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No abstract available |