Protein detail
EPHB4
Ephrin type-B receptor 4 (EC 2.7.10.1) (Hepatoma transmembrane kinase) (Tyrosine-protein kinase TYRO11)
Entry name EPHB4 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Ephrin type-B receptor 4 (EC 2.7.10.1) (Hepatoma transmembrane kinase) (Tyrosine-protein kinase TYRO11)
Protein Class (9)
Cancer-related genesDisease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (10)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Accessory Factors Involved in Transport
- Kinases:Tyr protein kinases
- Disease related genes
Transmembrane
540..560; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
HTKTyro11
Gene Description
EPH receptor B4
Chromosome
7
Position
100802565-100827523
Supporting publications (n)
2
EVMP confidence score
0.25
Fluorescence & Localization4
Cell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificvascular associated smooth muscle cellBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway7
Protein Function (10)
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Transporters:Accessory Factors Involved in Transport
- Kinases:Tyr protein kinases
- Disease related genes
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Reactome (5)
Mediation Categories (2)
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence71
Ligand-Receptor Signaling (66)
66 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | No | Yes | No |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EFNB2 | P52799 | EPHB4 | P54760 | Yes | Yes | No | iTALKICELLNETHINTCellPhoneDB_CellinkerSignaLink3HPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrHPRDIntActDLRP_talklrRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | Cellinker:15114347Cellinker:9718367connectomeDB2020:9718367HPRD:9718367SignaLink3:12051776Cellinker:12051776Baccin2019:9718367connectomeDB2020:7534404HINT:26481148SignaLink3:18988627HINT:16867992Baccin2019:7534404LRdb:11114742CellChatDB:15114347SignaLink3:23331499HPMR:7534404Baccin2019:12051776HINT:33961781CellTalkDB:15114347SignaLink3:9718367ICELLNET:24003208IntAct:26481148connectomeDB2020:12051776HPRD:12051776ICELLNET:15114347SignaLink3:9576626Cellinker:7534404 |
| EPHB4 | P54760 | NOS3 | P29474 | Yes | Yes | No | SIGNOR | SIGNOR:26817610 |
| EFNB1 | P98172 | EPHB4 | P54760 | Yes | Yes | No | iTALKICELLNETSIGNORCellPhoneDB_CellinkerHPMR_talklrCellChatDBDLRP_CellinkertalklrRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBBaccin2019CellinkerEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | connectomeDB2020:9330863ICELLNET:24003208SIGNOR:9330863Cellinker:15114347LRdb:11114742ICELLNET:15114347CellChatDB:15114347Baccin2019:9330863 |
Protein Complex Composition (1)
Sequence, Structure & Domains15
Sequences
Length
987
Mass
108,270
Sequence
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGTGGPAPQY
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P54760-1; Sequence=Displayed; Name=2; IsoId=P54760-2; Sequence=VSP_056024, VSP_056025; Name=3; IsoId=P54760-3; Sequence=VSP_056020, VSP_056021; Name=4; IsoId=P54760-4; Sequence=VSP_056022, VSP_056023
Alternative Sequence
270..306; ACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRV -> GRRGSQQRAVPEDVRKPGRAAGAEAGSQLPGAGTGAL (in isoform 3); 307..987; Missing (in isoform 3); 406..414; VTALNGVSS -> YLLQCLTSG (in isoform 4); 415..987; Missing (in isoform 4); 507..516; VRARSEAGYG -> RARAGGSSWP (in isoform 2); 517..987; Missing (in isoform 2)
3D Structural Models
Turn
151..153; 479..481; 708..710; 815..817; 820..823
Helix
23..25; 97..99; 612..614; 655..668; 701..707; 714..733; 743..745; 765..767; 784..786; 789..794; 799..814; 826..834; 847..856; 861..863; 867..879; 881..884; 912..918; 922..924; 925..930; 936..939; 944..950; 955..965
Beta Strand
17..22; 33..36; 43..48; 54..61; 63..65; 70..74; 84..95; 109..121; 130..132; 135..142; 147..150; 154..156; 160..166; 171..182; 184..196; 441..446; 449..453; 460..462; 466..473; 482..496; 503..510; 615..623; 625..634; 637..639; 642..649; 679..683; 685..694; 746..748; 754..756; 761..763
3D Structure
NMR spectroscopy (1); X-ray crystallography (22)
Domain & Motif Annotations
Compositional Bias
976..987; Gly residues
Motif
985..987; PDZ-binding
Domain (FT)
17..202; Eph LBD; 323..432; Fibronectin type-III 1; 436..529; Fibronectin type-III 2; 615..899; Protein kinase; 907..971; SAM
Region
965..987; Disordered
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- Ephrin receptor subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
Clinical Relevance8
Disease Involvement (2)
Cancer-related genesDisease variant
Related Diseases (6)
Biomarker
Phase 2; Investigative
Drugs (4)
Antibody
Interaction Protein (2)
ENSG00000125266ENSG00000135333
Interaction Count
2
Interaction Dataset
intact_biogrid