Protein detail

EPHB4

Ephrin type-B receptor 4 (EC 2.7.10.1) (Hepatoma transmembrane kinase) (Tyrosine-protein kinase TYRO11)

Entry name EPHB4	UniProt ID P54760	EVMP confidence score 0.25
Supporting publications (n) 2	Transmembrane count 1	Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Ephrin type-B receptor 4 (EC 2.7.10.1) (Hepatoma transmembrane kinase) (Tyrosine-protein kinase TYRO11)

Protein Class (9)

Cancer-related genesDisease related genesEnzymesHuman disease related genesPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (10)

Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
Enzymes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Transporters:Accessory Factors Involved in Transport
Kinases:Tyr protein kinases
Disease related genes

Transmembrane

540..560; Helical

Transmembrane Count

Ensembl

ENSG00000196411

Entrez Gene Symbol

EPHB4

Gene Synonym (2)

HTKTyro11

Gene Description

EPH receptor B4

Chromosome

Position

100802565-100827523

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization4

Cell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificvascular associated smooth muscle cellBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells

Function & Pathway7

Protein Function (10)

Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
Enzymes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Transporters:Accessory Factors Involved in Transport
Kinases:Tyr protein kinases
Disease related genes

Cellular Component (5)

Molecular Function (4)

Biological Process (3)

KEGG

hsa04360 Axon guidance

Reactome (5)

Mediation Categories (2)

Clinical-translation mediationReceptor-signaling mediation

Relations & Evidence71

Ligand-Receptor Signaling (66)

66 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	Baccin2019	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Zhong2015	Yes	Yes	No	Yes	No
icam	cell_adhesion	Zhong2015	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No

Page 3 of 7Previous Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
EFNB2	P52799	EPHB4	P54760	Yes	Yes	No	iTALKICELLNETHINTCellPhoneDB_CellinkerSignaLink3HPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrHPRDIntActDLRP_talklrRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	Cellinker:15114347 Cellinker:9718367 connectomeDB2020:9718367 HPRD:9718367 SignaLink3:12051776 Cellinker:12051776 Baccin2019:9718367 connectomeDB2020:7534404 HINT:26481148 SignaLink3:18988627 HINT:16867992 Baccin2019:7534404 LRdb:11114742 CellChatDB:15114347 SignaLink3:23331499 HPMR:7534404 Baccin2019:12051776 HINT:33961781 CellTalkDB:15114347 SignaLink3:9718367 ICELLNET:24003208 IntAct:26481148 connectomeDB2020:12051776 HPRD:12051776 ICELLNET:15114347 SignaLink3:9576626 Cellinker:7534404
EPHB4	P54760	NOS3	P29474	Yes	Yes	No	SIGNOR	SIGNOR:26817610
EFNB1	P98172	EPHB4	P54760	Yes	Yes	No	iTALKICELLNETSIGNORCellPhoneDB_CellinkerHPMR_talklrCellChatDBDLRP_CellinkertalklrRamilowski2015_Baccin2019DLRP_talklrWangRamilowski2015HPMR_LRdbCellPhoneDBBaccin2019CellinkerEMBRACECellCallCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	connectomeDB2020:9330863 ICELLNET:24003208 SIGNOR:9330863 Cellinker:15114347 LRdb:11114742 ICELLNET:15114347 CellChatDB:15114347 Baccin2019:9330863

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	EPHB4	P54760	2	PDB	PDB:2qkqPDB:2yn8PDB:6fnjPDB:3zew

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	3	38113368 32560723 33441949

Sequence, Structure & Domains15

Sequences

Length

987

Mass

108,270

Sequence

MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLALIAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKKILASVQHMKSQAKPGTPGGTGGPAPQY

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P54760-1; Sequence=Displayed; Name=2; IsoId=P54760-2; Sequence=VSP_056024, VSP_056025; Name=3; IsoId=P54760-3; Sequence=VSP_056020, VSP_056021; Name=4; IsoId=P54760-4; Sequence=VSP_056022, VSP_056023

Alternative Sequence

270..306; ACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRV -> GRRGSQQRAVPEDVRKPGRAAGAEAGSQLPGAGTGAL (in isoform 3); 307..987; Missing (in isoform 3); 406..414; VTALNGVSS -> YLLQCLTSG (in isoform 4); 415..987; Missing (in isoform 4); 507..516; VRARSEAGYG -> RARAGGSSWP (in isoform 2); 517..987; Missing (in isoform 2)

3D Structural Models

Turn

151..153; 479..481; 708..710; 815..817; 820..823

Helix

23..25; 97..99; 612..614; 655..668; 701..707; 714..733; 743..745; 765..767; 784..786; 789..794; 799..814; 826..834; 847..856; 861..863; 867..879; 881..884; 912..918; 922..924; 925..930; 936..939; 944..950; 955..965

Beta Strand

17..22; 33..36; 43..48; 54..61; 63..65; 70..74; 84..95; 109..121; 130..132; 135..142; 147..150; 154..156; 160..166; 171..182; 184..196; 441..446; 449..453; 460..462; 466..473; 482..496; 503..510; 615..623; 625..634; 637..639; 642..649; 679..683; 685..694; 746..748; 754..756; 761..763

3D Structure

NMR spectroscopy (1); X-ray crystallography (22)

Domain & Motif Annotations

Compositional Bias

976..987; Gly residues

Motif

985..987; PDZ-binding

Domain (FT)

17..202; Eph LBD; 323..432; Fibronectin type-III 1; 436..529; Fibronectin type-III 2; 615..899; Protein kinase; 907..971; SAM

Region

965..987; Disordered

Protein Families (3)

Protein kinase superfamily
Tyr protein kinase family
Ephrin receptor subfamily

Sequence Similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.

Clinical Relevance8

Disease Involvement (2)

Cancer-related genesDisease variant

Related Diseases (6)

Brain cancer Cystic/dysplastic kidney disease Lung cancer Metastatic meninges neoplasm Metastatic tumour Solid tumour/cancer

Biomarker

Phase 2; Investigative

Drugs (4)

TG100-801 JI-101 TESEVATINIB VANDETANIB

Antibody

CAB013537

Interaction Protein (2)

ENSG00000125266ENSG00000135333

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications2

PMID	Title	Abstract
30301952	A position on vision.	No abstract available
38343172	Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles.	No abstract available