Protein detail
EMP3
Epithelial membrane protein 3 (EMP-3) (Hematopoietic neural membrane protein 1) (HNMP-1) (Protein YMP)
Entry name EMP3 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 13 | Transmembrane count 4 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Epithelial membrane protein 3 (EMP-3) (Hematopoietic neural membrane protein 1) (HNMP-1) (Protein YMP)
Protein Function
Predicted intracellular proteins
Transmembrane
4..24; Helical; 66..86; Helical; 100..120; Helical; 139..159; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
13
EVMP confidence score
0.72
Fluorescence & Localization5
Tissue SpecificintestineCell SpecificEnteric stem cellsSecretome LocationSecreted to digestive systemSecretome FunctionCell adhesion
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence11
Ligand-Receptor Signaling (10)
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
| plasma_membrane_regulator | plasma_membrane_regulator | Almen2009 | No | No | No | No | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains5
Sequences
Length
163
Mass
18,429
Sequence
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Domain & Motif Annotations
Protein Families
PMP-22/EMP/MP20 family
Sequence Similarities
Belongs to the PMP-22/EMP/MP20 family.
Clinical Relevance1
Supporting Publications13
| PMID | Title | Abstract |
|---|---|---|
| 39001700 | Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles. | No abstract available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |
Page 2 of 2Previous