Protein detail

RAD

GTP-binding protein RAD (RAD1) (Ras associated with diabetes)

Entry name RAD	UniProt ID P55042	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

GTP-binding protein RAD (RAD1) (Ras associated with diabetes)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000166592

Entrez Gene Symbol

RRAD

Gene Synonym (2)

RADREM3

Gene Description

RRAD, Ras related glycolysis inhibitor and calcium channel regulator

Chromosome

Position

66921679-66925536

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Tissue SpecificpancreasCell SpecificCorticotrophsBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (2)

Molecular Function (5)

Biological Process (3)

Reactome (4)

Canonical Pathways (2)

M56 Pid lpa4 pathway
M15 Pid lysophospholipid pathway

Mediation Categories (2)

Fusion and delivery mediationReceptor-signaling mediation

Relations & Evidence34

Enzyme-Mediated Modification (22)

22 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
RRAD	CSNK2A1	P68400	S	299	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:9677319 ProtMapper:9677319
RRAD	CSNK2A1	P68400	S	214	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:9677319
RRAD	CSNK2A1	P68400	S	290	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:9677319
RRAD	CSNK2A1	P68400	S	257	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:7876254 KEA:9677319
RRAD	CSNK2A1	P68400	S	273	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:7876254 KEA:9677319
RRAD	PRKCB	P05771	S	290	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:9677319
RRAD	PRKCB	P05771	S	214	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:9677319
RRAD	PRKCB	P05771	S	273	phosphorylation	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:9677319 ProtMapper:9677319
RRAD	PRKCB	P05771	S	257	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:7876254 KEA:9677319
RRAD	PRKCB	P05771	S	299	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:9677319 ProtMapper:9677319 KEA:9677319

Page 1 of 3Next

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Regulatory Interaction Network (5)

5 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KCC2G	Q13555	RAD	P55042	Yes	No	No	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDHINTPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper	ProtMapper:9677319 ProtMapper:7876254 HINT:9115241 KEA:7876254 KEA:9677319 SIGNOR:9677319 HINT:9677319 HPRD:9677319 HPRD:7876254
CSK21	P68400	RAD	P55042	Yes	No	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:9677319 PhosphoSite:9677319 ProtMapper:7876254 KEA:7876254 KEA:9677319 SIGNOR:9677319 HPRD:9677319 HPRD:7876254
KPCB	P05771	RAD	P55042	Yes	No	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper	ProtMapper:9677319 ProtMapper:7876254 KEA:7876254 KEA:9677319 SIGNOR:9677319 HPRD:9677319 HPRD:7876254
KPCA	P17252	RAD	P55042	Yes	No	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDHINTPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:9677319 ProtMapper:7876254 KEA:7876254 KEA:9677319 HINT:7876254 SIGNOR:9677319 HINT:9677319 HPRD:9677319 HPRD:7876254
KAPCA	P17612	RAD	P55042	Yes	No	No	PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDHINTKEABioGRIDHPRD_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:9677319 ProtMapper:7876254 BioGRID:7876254 KEA:7876254 KEA:9677319 HINT:7876254 SIGNOR:9677319 HINT:9677319 HPRD:9677319 HPRD:7876254

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	RRAD	P55042	2	PDB	PDB:2gjsPDB:2dpxPDB:3q7pPDB:3q72PDB:3q7q

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
PRotein Organic Solvent Precipitation；Differential Ultracentrifugation	Mass spectrometry	1	32384937

Sequence, Structure & Domains10

Sequences

Length

308

Mass

33,245

Sequence

MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL

3D Structural Models

Helix

104..111; 155..159; 174..189; 208..210; 215..224; 234..236; 240..254

Beta Strand

93..99; 126..133; 136..144; 164..170; 198..203; 228..231

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Compositional Bias

1..16; Gly residues; 48..68; Low complexity

Region

1..88; Disordered; 278..297; Calmodulin-binding

Protein Families (2)

Small GTPase superfamily
RGK family

Sequence Similarities

Belongs to the small GTPase superfamily. RGK family.

Clinical Relevance4

Antibody

HPA041755

Interaction Protein

ENSG00000166946

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
38453052	RAS protein activator-like 2 (RASAL2) initiates peritubular capillary rarefaction in hypoxic renal interstitial fibrosis.	Hypoxia increased the production of RASAL2-enriched extracellular vesicles (EVs) derived from tubular cells, which were internalized by endothelial cells, contributing to the exacerbation of PTC loss.