Protein detail
RAD
GTP-binding protein RAD (RAD1) (Ras associated with diabetes)
Entry name RAD | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
GTP-binding protein RAD (RAD1) (Ras associated with diabetes)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
RADREM3
Gene Description
RRAD, Ras related glycolysis inhibitor and calcium channel regulator
Chromosome
16
Position
66921679-66925536
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificpancreasCell SpecificCorticotrophsBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (5)
Biological Process (3)
Reactome (4)
Canonical Pathways (2)
- M56 Pid lpa4 pathway
- M15 Pid lysophospholipid pathway
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence34
Enzyme-Mediated Modification (22)
22 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| RRAD | CSNK2A1 | P68400 | S | 299 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9677319ProtMapper:9677319 |
| RRAD | CSNK2A1 | P68400 | S | 214 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:9677319 |
| RRAD | CSNK2A1 | P68400 | S | 290 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:9677319 |
| RRAD | CSNK2A1 | P68400 | S | 257 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:7876254KEA:9677319 |
| RRAD | CSNK2A1 | P68400 | S | 273 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:7876254KEA:9677319 |
| RRAD | PRKCB | P05771 | S | 290 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:9677319 |
| RRAD | PRKCB | P05771 | S | 214 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:9677319 |
| RRAD | PRKCB | P05771 | S | 273 | phosphorylation | SIGNOR_ProtMapperSIGNORProtMapper | SIGNOR:9677319ProtMapper:9677319 |
| RRAD | PRKCB | P05771 | S | 257 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:7876254KEA:9677319 |
| RRAD | PRKCB | P05771 | S | 299 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | SIGNOR:9677319ProtMapper:9677319KEA:9677319 |
Page 1 of 3Next
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KCC2G | Q13555 | RAD | P55042 | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDHINTPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | ProtMapper:9677319ProtMapper:7876254HINT:9115241KEA:7876254KEA:9677319SIGNOR:9677319HINT:9677319HPRD:9677319HPRD:7876254 | ||
| CSK21 | P68400 | RAD | P55042 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:9677319PhosphoSite:9677319ProtMapper:7876254KEA:7876254KEA:9677319SIGNOR:9677319HPRD:9677319HPRD:7876254 | ||
| KPCB | P05771 | RAD | P55042 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | ProtMapper:9677319ProtMapper:7876254KEA:7876254KEA:9677319SIGNOR:9677319HPRD:9677319HPRD:7876254 | ||
| KPCA | P17252 | RAD | P55042 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDHINTPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:9677319ProtMapper:7876254KEA:7876254KEA:9677319HINT:7876254SIGNOR:9677319HINT:9677319HPRD:9677319HPRD:7876254 | ||
| KAPCA | P17612 | RAD | P55042 | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDHINTKEABioGRIDHPRD_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:9677319ProtMapper:7876254BioGRID:7876254KEA:7876254KEA:9677319HINT:7876254SIGNOR:9677319HINT:9677319HPRD:9677319HPRD:7876254 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation;Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
308
Mass
33,245
Sequence
MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL
3D Structural Models
Helix
104..111; 155..159; 174..189; 208..210; 215..224; 234..236; 240..254
Beta Strand
93..99; 126..133; 136..144; 164..170; 198..203; 228..231
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Compositional Bias
1..16; Gly residues; 48..68; Low complexity
Region
1..88; Disordered; 278..297; Calmodulin-binding
Protein Families (2)
- Small GTPase superfamily
- RGK family
Sequence Similarities
Belongs to the small GTPase superfamily. RGK family.
Clinical Relevance
Antibody
Interaction Protein
ENSG00000166946
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38453052 | RAS protein activator-like 2 (RASAL2) initiates peritubular capillary rarefaction in hypoxic renal interstitial fibrosis. | Hypoxia increased the production of RASAL2-enriched extracellular vesicles (EVs) derived from tubular cells, which were internalized by endothelial cells, contributing to the exacerbation of PTC loss. |