Protein detail
AFAD
Afadin (ALL1-fused gene from chromosome 6 protein) (Protein AF-6) (Afadin adherens junction formation factor)
Entry name AFAD | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Cancer-related genesDisease related genesPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Afadin (ALL1-fused gene from chromosome 6 protein) (Protein AF-6) (Afadin adherens junction formation factor)
Protein Class (5)
Cancer-related genesDisease related genesPlasma proteinsPredicted intracellular proteinsRAS pathway related proteins
Protein Function (4)
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
- Cancer-related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
AF-6AF6MLLT4
Gene Description
Afadin, adherens junction formation factor
Chromosome
6
Position
167826893-167972023
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue SpecificbrainCell SpecificcDCBlood Cell Specificclassical monocyteBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (4)
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
- Cancer-related genes
Cellular Component (10)
Molecular Function (5)
Biological Process (3)
KEGG (8)
Reactome (3)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence51
Enzyme-Mediated Modification (12)
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| AFDN | BCR | P11274 | T | 909 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| AFDN | BCR | P11274 | T | 893 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPKEA | KEA:12808105 |
| AFDN | BCR | P11274 | T | 908 | phosphorylation | KEA | KEA:12808105 |
| AFDN | CDK2 | P24941 | T | 1,352 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| AFDN | CDK2 | P24941 | T | 1,335 | phosphorylation | MIMPPhosphoSite_MIMP | |
| AFDN | PRKCI | P41743 | S | 1,166 | phosphorylation | PhosphoNetworks | |
| AFDN | CDK1 | P06493 | S | 1,156 | phosphorylation | KEA | KEA:17570479 |
| AFDN | CDK1 | P06493 | S | 1,165 | phosphorylation | KEA | KEA:17570479 |
| AFDN | GSK3B | P49841 | S | 1,165 | phosphorylation | KEA | KEA:17570479 |
| AFDN | MAPK14 | Q16539 | S | 1,165 | phosphorylation | KEA | KEA:17570479 |
Page 1 of 2Next
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | No | No | No |
| tight_junction | tight_junction | OmniPath | Yes | Yes | No | No | No |
| adherens_junction | adherens_junction | Ramilowski_location | No | Yes | No | No | No |
| adherens_junction | adherens_junction | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EPHB3 | P54753 | AFAD | P55196 | Yes | Yes | No | DOMINOPhosphoPointHPRDSignaLink3SPIKE_LCLit-BM-17 | SPIKE_LC:9707552DOMINO:9707552SignaLink3:9707552SignaLink3:23331499Lit-BM-17:9707552HPRD:9707552 |
| AFAD | P55196 | RIN1 | Q13671 | Yes | Yes | No | SIGNOR | SIGNOR:10545207 |
| AFAD | P55196 | RIT1 | Q92963 | Yes | Yes | No | InnateDBHPRDSPIKE_LCSIGNOR | SIGNOR:10545207SPIKE_LC:17145710HPRD:10545207InnateDB:10545207 |
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| AFDNEIF3DRAP1ARAP2ARAPGEF4RAPGEF6RGS12 | O14924O15371P10114P55196P62834Q8TEU7Q8WZA2 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6493 | ||
| AFDNRAP1ARAP2ARAPGEF4RAPGEF6RGS12UBC | O14924P0CG48P10114P55196P62834Q8TEU7Q8WZA2 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC3842 | ||
| AFDNRAP1ARAP2ARAPGEF4RAPGEF6RGS12RRAS2 | O14924P10114P55196P62070P62834Q8TEU7Q8WZA2 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5998 | ||
| AFDNEIF3DRAP1ARAP2ARAPGEF4TRAF6 | O15371P10114P55196P62834Q8WZA2Q9Y4K3 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6740 | ||
| AFDNMINK1RAP1ARAP2ARAPGEF4RAPGEF6RRAS2 | P10114P55196P62070P62834Q8N4C8Q8TEU7Q8WZA2 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8546 | ||
| AFDNRAB5ARAB5BRIN1RIT2RRAS2 | P20339P55196P61020P62070Q13671Q99578 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7517 | ||
| AFDN | P55196 | 2 | PDB | PDB:5a6c |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains14
Sequences
Length
1,824
Mass
206,804
Sequence
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHLEGKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISETTMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQDASGPELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSTQNGSPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYASGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHMHTDSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSLDSSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPPVHYAGDFDGMSMDLPLPPPPSANQIGLPSAQVAAAERRKREEHQRWYEKEKARLEEERERKRREQERKLGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEAPGLCRPPLPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEEEDCSLAGPNSYPGSTGAAVGAHDACRDAKEKRSKSQDADSPGSSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENELNTK
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=4; IsoId=P55196-4; Sequence=Displayed; Name=1; Synonyms=s-afadin; IsoId=P55196-2; Sequence=VSP_038707, VSP_038708, VSP_000217, VSP_000218; Name=2; Synonyms=l-afadin; IsoId=P55196-1; Sequence=VSP_038707, VSP_038708, VSP_038709, VSP_038711; Name=3; IsoId=P55196-3; Sequence=VSP_038707, VSP_038708, VSP_038709, VSP_038710; Name=6; IsoId=P55196-6; Sequence=VSP_041197, VSP_041198, VSP_041199; Name=5; IsoId=P55196-5; Sequence=VSP_038707, VSP_019257
Alternative Sequence
139; Missing (in isoform 1, isoform 2, isoform 3 and isoform 5); 393..407; Missing (in isoform 1, isoform 2 and isoform 3); 1048; Missing (in isoform 2 and isoform 3); 1604; R -> RTAMPAISVLDL (in isoform 5); 1605..1628; LQDEERRRQQQLEEMRKREAEDRA -> VKGGVLWLCPSVVPILASACFPWG (in isoform 1); 1605..1606; Missing (in isoform 6); 1629..1824; Missing (in isoform 1); 1650..1653; RRQE -> VMVL (in isoform 6); 1654..1824; Missing (in isoform 6); 1683..1746; Missing (in isoform 3); 1747..1824; PNSYPGSTGAAVGAHDACRDAKEKRSKSQDADSPGSSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENELNTK -> QDKYSSTRKSHGDLLPAPLKPRPPPCQPRPASDGVFLSNSFQPPSAKANSTAHKKGQPLPPPKKSSSYHPSHCKGRGKRVTNQLSLS (in isoform 2)
3D Structural Models
Turn
1722..1724; 1735..1738
Helix
1045..1049; 1071..1079
Beta Strand
1007..1013; 1015..1017; 1020..1025; 1028..1031; 1034..1040; 1042..1044; 1057..1061; 1083..1090
3D Structure
NMR spectroscopy (4); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
160..172; Basic residues; 173..189; Basic and acidic residues; 349..371; Basic and acidic residues; 580..591; Basic and acidic residues; 1113..1128; Basic and acidic residues; 1132..1143; Polar residues; 1152..1172; Basic and acidic residues; 1190..1210; Polar residues; 1252..1262; Basic and acidic residues; 1274..1302; Basic and acidic residues; 1309..1318; Low complexity; 1325..1337; Polar residues; 1345..1356; Low complexity; 1364..1373; Pro residues; 1407..1441; Basic and acidic residues; 1515..1528; Basic and acidic residues; 1578..1589; Acidic residues; 1597..1677; Basic and acidic residues; 1694..1709; Pro residues; 1762..1776; Basic and acidic residues; 1813..1824; Basic and acidic residues
Coiled Coil
146..185; 1408..1448; 1523..1667
Domain (CC)
The PDZ/DHR domain interacts with the C-terminus of nectin and the Pro-rich C-terminal domain interacts with F-actin.
Domain (FT)
39..133; Ras-associating 1; 246..348; Ras-associating 2; 426..492; FHA; 668..908; Dilute; 1007..1093; PDZ
Region
128..194; Disordered; 349..378; Disordered; 534..595; Disordered; 1107..1223; Disordered; 1235..1473; Disordered; 1501..1528; Disordered; 1569..1824; Disordered
Clinical Relevance5
Disease Involvement (2)
Cancer-related genesProto-oncogene
Interaction Protein (8)
ENSG00000108953ENSG00000128245ENSG00000130202ENSG00000135363ENSG00000164924ENSG00000166913ENSG00000170027ENSG00000177707
Interaction Count
8
Interaction Dataset (3)
biogrid_opencellintact_biogridintact_biogrid_opencell
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |