Protein detail

CADH6

Cadherin-6 (Kidney cadherin) (K-cadherin)

Entry name CADH6	UniProt ID P55285	EVMP confidence score 0.63
Supporting publications (n) 7	Transmembrane count 1	Protein classification Plasma proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Cadherin-6 (Kidney cadherin) (K-cadherin)

Protein Class (2)

Plasma proteinsPredicted membrane proteins

Transmembrane

616..636; Helical

Transmembrane Count

Ensembl

ENSG00000113361

Entrez Gene Symbol

CDH6

Gene Description

Cadherin 6

Chromosome

Position

31193686-31329146

Supporting publications (n)

EVMP confidence score

0.63

Function & Pathway6

Cellular Component (6)

Molecular Function (3)

Biological Process (3)

KEGG

hsa04519 Cadherin signaling

Reactome (3)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence40

Ligand-Receptor Signaling (37)

37 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	Yes	No
type2_classical_cadherin	cell_adhesion	HGNC	Yes	Yes	No	Yes	No
adhesion	adhesion	HGNC	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Zhong2015	Yes	Yes	No	Yes	No
icam	cell_adhesion	Zhong2015	Yes	Yes	No	Yes	No

Page 1 of 4Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
CADH6	P55285	CTNB1	P35222	Yes	Yes	No	SIGNORBioGRID	BioGRID:10207020 SIGNOR:21255999

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CDH6 IGKC S6B291	P01834 P55285 S6B291	2:2:2	PDB	PDB:5veb

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	R Sequencing	3	26775013 40098346 38136601

Sequence, Structure & Domains12

Sequences

Length

790

Mass

88,309

Sequence

MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQFFLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPGTPIGRIKASDADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYSVDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLPRRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADMYGGVDSDKDS

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P55285-1; Sequence=Displayed; Name=2; IsoId=P55285-2; Sequence=VSP_000636, VSP_000637

Alternative Sequence

628..663; VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG -> GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI (in isoform 2); 664..790; Missing (in isoform 2)

3D Structural Models

Turn

529..531; 558..560

Beta Strand

495..497; 505..512; 524..527; 532..534; 536..541; 543..551; 562..571; 573..576; 579..589

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

269..279; Polar residues

Domain (CC)

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.

Domain (FT)

54..159; Cadherin 1; 160..268; Cadherin 2; 269..383; Cadherin 3; 384..486; Cadherin 4; 487..608; Cadherin 5

Region

259..288; Disordered

Clinical Relevance3

Related Diseases

Ovarian cancer

Biomarker

Phase 1

Antibody (4)

HPA007047 HPA007403 HPA007456 CAB025274

Supporting Publications7

PMID	Title	Abstract
29423001	Hypoxia increases amyloid-β level in exosomes by enhancing the interaction between CD147 and Hook1.	Aβ is also found in exosomes that participate in the intercellular communication and amyloids propagation. CD147 is considered as an additional subunit of γ-secretase regulated by hypoxia, and has been identified in exosomes. Our results showed that hypoxia increased the levels of Aβ40 and Aβ42 in exosomes and enhanced the interaction between CD147 and Hook1 in SH-SY5YAPP This study was to investigate the role of CD147 in hypoxia-induced accumulation of Aβ in exosomes.
35892564	CD147 Promotes Tumorigenesis via Exosome-Mediated Signaling in Rhabdomyosarcoma.	Altogether, our results demonstrate that CD147 contributes to RMS tumor cell aggressiveness, and is involved in modulating the microenvironment through RMS-secreted exosomes. Targeted inhibition of CD147 reduces its expression levels within the isolated exosomes and reduces the capacity of these exosomes to enhance cellular invasive properties. The transmembrane protein CD147, also known as Basigin or EMMPRIN, is enriched in various tumor cells, as well as in tumor-derived exosomes, and has been correlated with poor prognosis in several types of cancer, but has not been previously investigated in RMS. While treatment of normal fibroblasts with RMS-derived exosomes results in a significant increase in proliferation, migration, and invasion, these effects are reversed when using exosomes from CD147-downregulated RMS cells.
36359760	Extracellular Vesicles Isolated from Plasma of Multiple Myeloma Patients Treated with Daratumumab Express CD38, PD-L1, and the Complement Inhibitory Proteins CD55 and CD59.	No abstract available
36973758	The glycoprotein CD147 defines miRNA-enriched extracellular vesicles that derive from cancer cells.	No abstract available
37562522	Identification of CD147-positive extracellular vesicles as novel non-invasive biomarkers for the diagnosis and prognosis of colorectal cancer.	No abstract available
37812687	Multiplex Quantification of Exosomes via Multiple Types of Nanobeads Labeling Combined with Laser Scanning Detection.	Furthermore, CD147-positive, HER2-positive, and CD81-positive exosomes in 12.5 μL of serum were simultaneously quantified with high discrimination performance using the anti-CD147 antibody, anti-HER2 antibody, or anti-CD81 antibody conjugated for FG beads, Au nanobeads, or Ag nanobeads, respectively.
38360687	Targeting cancer-derived extracellular vesicles by combining CD147 inhibition with tissue factor pathway inhibitor for the management of urothelial cancer cells.	No abstract available