Protein detail
CADH6
Cadherin-6 (Kidney cadherin) (K-cadherin)
Entry name CADH6 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 7 | Transmembrane count 1 | Protein classification Plasma proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Cadherin-6 (Kidney cadherin) (K-cadherin)
Protein Class (2)
Plasma proteinsPredicted membrane proteins
Transmembrane
616..636; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
Cadherin 6
Chromosome
5
Position
31193686-31329146
Supporting publications (n)
7
EVMP confidence score
0.63
Function & Pathway6
Cellular Component (6)
Molecular Function (3)
Biological Process (3)
Reactome (3)
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence40
Ligand-Receptor Signaling (37)
37 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | No |
| type2_classical_cadherin | cell_adhesion | HGNC | Yes | Yes | No | Yes | No |
| adhesion | adhesion | HGNC | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | No | Yes | No |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | No | Yes | No |
Page 1 of 4Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CADH6 | P55285 | CTNB1 | P35222 | Yes | Yes | No | SIGNORBioGRID | BioGRID:10207020SIGNOR:21255999 |
Protein Complex Composition (1)
Sequence, Structure & Domains12
Sequences
Length
790
Mass
88,309
Sequence
MRTYRYFLLLFWVGQPYPTLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQFFLLEEYTGSDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDREEKPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATVPEMSDVGTFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIKTALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPGTPIGRIKASDADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVKYSVDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPVVISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLSTGALVAILLCIVILLVTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEGGGEEDTQAFDIGTLRNPEAIEDNKLRRDIVPEALFLPRRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADMYGGVDSDKDS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P55285-1; Sequence=Displayed; Name=2; IsoId=P55285-2; Sequence=VSP_000636, VSP_000637
Alternative Sequence
628..663; VTVVLFAALRRQRKKEPLIISKEDIRDNIVSYNDEG -> GKLVLPASYLPMVRGSHCYCDTLDLSASPIKAYSLI (in isoform 2); 664..790; Missing (in isoform 2)
3D Structural Models
Turn
529..531; 558..560
Beta Strand
495..497; 505..512; 524..527; 532..534; 536..541; 543..551; 562..571; 573..576; 579..589
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
269..279; Polar residues
Domain (CC)
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
Domain (FT)
54..159; Cadherin 1; 160..268; Cadherin 2; 269..383; Cadherin 3; 384..486; Cadherin 4; 487..608; Cadherin 5
Region
259..288; Disordered
Clinical Relevance3
Supporting Publications7
| PMID | Title | Abstract |
|---|---|---|
| 29423001 | Hypoxia increases amyloid-β level in exosomes by enhancing the interaction between CD147 and Hook1. | Aβ is also found in exosomes that participate in the intercellular communication and amyloids propagation. CD147 is considered as an additional subunit of γ-secretase regulated by hypoxia, and has been identified in exosomes. Our results showed that hypoxia increased the levels of Aβ40 and Aβ42 in exosomes and enhanced the interaction between CD147 and Hook1 in SH-SY5YAPP This study was to investigate the role of CD147 in hypoxia-induced accumulation of Aβ in exosomes. |
| 35892564 | CD147 Promotes Tumorigenesis via Exosome-Mediated Signaling in Rhabdomyosarcoma. | Altogether, our results demonstrate that CD147 contributes to RMS tumor cell aggressiveness, and is involved in modulating the microenvironment through RMS-secreted exosomes. Targeted inhibition of CD147 reduces its expression levels within the isolated exosomes and reduces the capacity of these exosomes to enhance cellular invasive properties. The transmembrane protein CD147, also known as Basigin or EMMPRIN, is enriched in various tumor cells, as well as in tumor-derived exosomes, and has been correlated with poor prognosis in several types of cancer, but has not been previously investigated in RMS. While treatment of normal fibroblasts with RMS-derived exosomes results in a significant increase in proliferation, migration, and invasion, these effects are reversed when using exosomes from CD147-downregulated RMS cells. |
| 36359760 | Extracellular Vesicles Isolated from Plasma of Multiple Myeloma Patients Treated with Daratumumab Express CD38, PD-L1, and the Complement Inhibitory Proteins CD55 and CD59. | No abstract available |
| 36973758 | The glycoprotein CD147 defines miRNA-enriched extracellular vesicles that derive from cancer cells. | No abstract available |
| 37562522 | Identification of CD147-positive extracellular vesicles as novel non-invasive biomarkers for the diagnosis and prognosis of colorectal cancer. | No abstract available |
| 37812687 | Multiplex Quantification of Exosomes via Multiple Types of Nanobeads Labeling Combined with Laser Scanning Detection. | Furthermore, CD147-positive, HER2-positive, and CD81-positive exosomes in 12.5 μL of serum were simultaneously quantified with high discrimination performance using the anti-CD147 antibody, anti-HER2 antibody, or anti-CD81 antibody conjugated for FG beads, Au nanobeads, or Ag nanobeads, respectively. |
| 38360687 | Targeting cancer-derived extracellular vesicles by combining CD147 inhibition with tissue factor pathway inhibitor for the management of urothelial cancer cells. | No abstract available |