Protein detail
CAD11
Cadherin-11 (OSF-4) (Osteoblast cadherin) (OB-cadherin)
Entry name CAD11 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 12 | Transmembrane count 1 | Protein classification Cancer-related genesDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cadherin-11 (OSF-4) (Osteoblast cadherin) (OB-cadherin)
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (4)
- Disease related genes
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Cancer-related genes
Transmembrane
618..640; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CAD11OB
Gene Description
Cadherin 11
Chromosome
16
Position
64943753-65126112
Supporting publications (n)
12
EVMP confidence score
0.72
Function & Pathway
Protein Function (4)
- Disease related genes
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Cancer-related genes
Cellular Component (8)
Molecular Function (3)
Biological Process (3)
Reactome (9)
- R-hsa-418990 adherens junctions interactions
- R-hsa-9833576 cdh11 homotypic and heterotypic interactions
- R-hsa-1500931 cell cell communication
- R-hsa-446728 cell junction organization
- R-hsa-9762292 regulation of cdh11 function
- R-hsa-9762293 regulation of cdh11 gene transcription
- R-hsa-9759811 regulation of cdh11 mrna translation by micrornas
- R-hsa-9764260 regulation of expression and function of type ii classical cadherins
- R-hsa-9759476 regulation of homotypic cell cell adhesion
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence41
Ligand-Receptor Signaling (39)
39 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | Baccin2019 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | Cellinker | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes | ||||
| transmembrane_phobius | transmembrane_predicted | Almen2009 | Yes | ||||
| transmembrane_sosui | transmembrane_predicted | Almen2009 | Yes | ||||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | Yes |
Page 4 of 4Previous
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CAD11 | P55287 | CTNB1 | P35222 | Yes | Yes | HPRDHINTSIGNORBioGRID | SIGNOR:21255999BioGRID:26224160HPRD:10029089HINT:25466890SIGNOR:10029089BioGRID:10029089HINT:36950384 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 40326690 |
Sequence, Structure & Domains
Sequences
Length
796
Mass
87,965
Sequence
MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFISNGPFKDTVTVKISVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYSIDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLDVNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENIITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDFINTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFKKLADLYGSKDTFDDDS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P55287-1; Sequence=Displayed; Name=2; IsoId=P55287-2; Sequence=VSP_000640, VSP_000641
Alternative Sequence
632..693; VIVVLFVTLRRQKKEPLIVFEEEDVRENIITYDDEGGGEEDTEAFDIATLQNPDGINGFIPR -> GCPSLMEPPSPREDMRLLYLGFQLMLFSYVKVNRRFCLLGVFIKLPFLYVVATESPTTLTSL (in isoform 2); 694..796; Missing (in isoform 2)
Domain & Motif Annotations
Domain (CC)
Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.
Domain (FT)
54..159; Cadherin 1; 160..268; Cadherin 2; 269..383; Cadherin 3; 384..486; Cadherin 4; 487..612; Cadherin 5
Clinical Relevance
Disease Involvement (4)
Cancer-related genesDeafnessDisease variantIntellectual disability
Related Diseases (3)
Biomarker
Phase 1
Drug Targets
Clinical trial target
Drugs
Antibody
Supporting Publications12
| PMID | Title | Related sentences |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 30550287 | Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes. | No related sentences available |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No related sentences available |
| 34681663 | Proteomic Landscape of Extracellular Vesicles for Diffuse Large B-Cell Lymphoma Subtyping. | No related sentences available |
| 36406491 | Automated Proteomics Sample Preparation of Phosphatidylserine-Positive Extracellular Vesicles from Human Body Fluids. | No related sentences available |
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38698420 | Single-sEV profiling identifies the TACSTD2 + sEV subpopulation as a factor of tumor susceptibility in the elderly. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 39104279 | A Predictive Model for Initial Platinum-Based Chemotherapy Efficacy in Patients with Postoperative Epithelial Ovarian Cancer Using Tissue-Derived Small Extracellular Vesicles. | No related sentences available |
Page 1 of 2Next