Protein detail
CAV3
Caveolin-3 (M-caveolin)
Protein symbol CAV3 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Caveolin-3 (M-caveolin)
Protein Class
Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- Potential drug targets
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
- Transporters:Transporter channels and pores
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Ensembl
Entrez Gene Symbol
Gene Synonym
LGMD1CLQT9VIP-21VIP21
Gene Description
Caveolin 3
Chromosome
3
Position
8733802-8841808
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- Potential drug targets
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
- Transporters:Transporter channels and pores
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005783 endoplasmic reticulum
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0005925 focal adhesion
- GO:0009986 cell surface
- GO:0014704 intercalated disc
- GO:0016010 dystrophin-associated glycoprotein complex
- GO:0030018 Z disc
- GO:0030315 T-tubule
- GO:0031594 neuromuscular junction
- GO:0031982 vesicle
- GO:0042383 sarcolemma
- GO:0043231 intracellular membrane-bounded organelle
- GO:0045121 membrane raft
Molecular Function
- GO:0005246 calcium channel regulator activity
- GO:0005515 protein binding
- GO:0017080 sodium channel regulator activity
- GO:0019870 potassium channel inhibitor activity
- GO:0043014 alpha-tubulin binding
- GO:0044325 transmembrane transporter binding
- GO:0044877 protein-containing complex binding
- GO:0050998 nitric-oxide synthase binding
- GO:0060090 molecular adaptor activity
- GO:0071253 connexin binding
Biological Process
KEGG
- hsa04144 Endocytosis
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa05020 Prion disease
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05410 Hypertrophic cardiomyopathy
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
- KEGG:hsa05414 Dilated cardiomyopathy
- KEGG:hsa05416 Viral myocarditis
- KEGG:hsa05418 Fluid shear stress and atherosclerosis
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
14 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | No | No | No |
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| peripheral | peripheral | UniProt_topology | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| PRotein Organic Solvent Precipitation；Differential Ultracentrifugation | Mass spectrometry | 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
151
Mass
17,259
Sequence
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
3D Structural Models
Domain & Motif Annotations
Region
64..114; Required for interaction with DAG1
Protein Families
Caveolin family
Sequence Similarities
Belongs to the caveolin family.