Protein detail

ARL4C

ADP-ribosylation factor-like protein 4C (ADP-ribosylation factor-like protein 7) (ADP-ribosylation factor-like protein LAK)

Entry name ARL4C	UniProt ID P56559	EVMP confidence score 0.53
Supporting publications (n) 5	Transmembrane count	Protein classification Predicted intracellular proteins

Basic Information

Protein Names

ADP-ribosylation factor-like protein 4C (ADP-ribosylation factor-like protein 7) (ADP-ribosylation factor-like protein LAK)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000188042

Entrez Gene Symbol

ARL4C

Gene Synonym (2)

ARL7LAK

Gene Description

ADP ribosylation factor like GTPase 4C

Chromosome

Position

234493041-234497081

Supporting publications (n)

EVMP confidence score

0.53

Fluorescence & Localization

Cell SpecificMonocyte progenitors

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function (4)

Biological Process (3)

Reactome (3)

Mediation Categories

Receptor-signaling mediation

Relations & Evidence11

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	UniProt_location
intracellular	intracellular	OmniPath
plasma_membrane	plasma_membrane	UniProt_location
plasma_membrane	plasma_membrane	OmniPath

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
ARL4C FBXO33 GADD45A RAD51B RAD51D RGS12 XRCC2	O14924 O15315 O43543 O75771 P24522 P56559 Q7Z6M2	0:0:0:0:0:0:0	hu.MAP2
ARL4C DCUN1D4 FBXO33 GADD45A RAD51B RAD51D RGS12 XRCC2	O14924 O15315 O43543 O75771 P24522 P56559 Q7Z6M2 Q92564	0:0:0:0:0:0:0:0	hu.MAP2
ARL4C DCUN1D4 FBXO33 GADD45A RGS12	O14924 P24522 P56559 Q7Z6M2 Q92564	0:0:0:0:0	hu.MAP2
ARL4C DCUN1D4 FBXO33 GADD45A XRCC2	O43543 P24522 P56559 Q7Z6M2 Q92564	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	11	40465195 41068253 33592500 40940449 37563857 38917926 41307968 40840701 38207106 39207047 37926756

Sequence, Structure & Domains

Sequences

Length

192

Mass

21,487

Sequence

MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P56559-1; Sequence=Displayed; Name=2; IsoId=P56559-2; Sequence=VSP_055120

Alternative Sequence

192; R -> RTGDLRSCEV (in isoform 2)

Domain & Motif Annotations

Protein Families (2)

Small GTPase superfamily
Arf family

Sequence Similarities

Belongs to the small GTPase superfamily. Arf family.

Clinical Relevance

Antibody

HPA028927

Supporting Publications5

PMID	Title	Related sentences
26884841	Exosomes mediated pentose phosphate pathway in ovarian cancer metastasis: a proteomics analysis.	No related sentences available
30608700	Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs.	No related sentences available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No related sentences available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No related sentences available