Protein detail
ARL4C
ADP-ribosylation factor-like protein 4C (ADP-ribosylation factor-like protein 7) (ADP-ribosylation factor-like protein LAK)
Entry name ARL4C | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 5 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
ADP-ribosylation factor-like protein 4C (ADP-ribosylation factor-like protein 7) (ADP-ribosylation factor-like protein LAK)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ARL7LAK
Gene Description
ADP ribosylation factor like GTPase 4C
Chromosome
2
Position
234493041-234497081
Supporting publications (n)
5
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificMonocyte progenitors
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
Reactome (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence11
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARL4CFBXO33GADD45ARAD51BRAD51DRGS12XRCC2 | O14924O15315O43543O75771P24522P56559Q7Z6M2 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| ARL4CDCUN1D4FBXO33GADD45ARAD51BRAD51DRGS12XRCC2 | O14924O15315O43543O75771P24522P56559Q7Z6M2Q92564 | 0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| ARL4CDCUN1D4FBXO33GADD45ARGS12 | O14924P24522P56559Q7Z6M2Q92564 | 0:0:0:0:0 | hu.MAP2 | |||
| ARL4CDCUN1D4FBXO33GADD45AXRCC2 | O43543P24522P56559Q7Z6M2Q92564 | 0:0:0:0:0 | hu.MAP2 |
Sequence, Structure & Domains7
Sequences
Length
192
Mass
21,487
Sequence
MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P56559-1; Sequence=Displayed; Name=2; IsoId=P56559-2; Sequence=VSP_055120
Alternative Sequence
192; R -> RTGDLRSCEV (in isoform 2)
Domain & Motif Annotations
Protein Families (2)
- Small GTPase superfamily
- Arf family
Sequence Similarities
Belongs to the small GTPase superfamily. Arf family.
Clinical Relevance1
Antibody
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 26884841 | Exosomes mediated pentose phosphate pathway in ovarian cancer metastasis: a proteomics analysis. | No abstract available |
| 30608700 | Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |