Protein detail

CLD12

Claudin-12

Entry name CLD12	UniProt ID P56749	EVMP confidence score 0.25
Supporting publications (n) 4	Transmembrane count 4	Protein classification Predicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Claudin-12

Protein Class

Predicted membrane proteins

Transmembrane

11..31; Helical; 88..108; Helical; 136..156; Helical; 175..195; Helical

Transmembrane Count

Ensembl

ENSG00000157224

Entrez Gene Symbol

CLDN12

Gene Description

Claudin 12

Chromosome

Position

90383721-90513402

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization5

Tissue SpecificesophagusBrain Regional Specificchoroid plexusCell SpecificBreast secretory cellsBlood Cell SpecificeosinophilBlood Lineage Specificdendritic cells

Function & Pathway7

Cellular Component (3)

Molecular Function (2)

Biological Process (3)

KEGG (7)

Reactome (3)

Canonical Pathways (3)

M290 Pid il12 stat4 pathway
M88 Pid cd8 tcr pathway
M34 Pid tcr pathway

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence26

Ligand-Receptor Signaling (25)

25 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
tight_junction	tight_junction	GO_Intercell	Yes	Yes	No	Yes	No
tight_junction	tight_junction	Ramilowski_location	Yes	Yes	No	Yes	No
tight_junction	tight_junction	Zhong2015	Yes	Yes	No	Yes	No
tight_junction	tight_junction	HGNC	Yes	Yes	No	Yes	No
claudin	tight_junction	Almen2009	Yes	Yes	No	Yes	No

Page 1 of 3Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	27605433

Sequence, Structure & Domains5

Sequences

Length

244

Mass

27,110

Sequence

MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT

Domain & Motif Annotations

Protein Families

Claudin family

Sequence Similarities

Belongs to the claudin family.

Clinical Relevance1

Antibody

HPA026945

Supporting Publications4

PMID	Title	Abstract
19837982	Proteomics analysis of A33 immunoaffinity-purified exosomes released from the human colon tumor cell line LIM1215 reveals a tissue-specific protein signature.	A conspicuous finding of this comparative analysis was the presence of host cell-specific (LIM1215 exosome) proteins such as A33, cadherin-17, carcinoembryonic antigen, epithelial cell surface antigen (EpCAM), proliferating cell nuclear antigen, epidermal growth factor receptor, mucin 13, misshapen-like kinase 1, keratin 18, mitogen-activated protein kinase 4, claudins (1, 3, and 7), centrosomal protein 55 kDa, and ephrin-B1 and -B2. Here, we describe an immunoaffinity capture method using the colon epithelial cell-specific A33 antibody to purify colorectal cancer cell (LIM1215)-derived exosomes.
37352782	MXenes-Au NPs modified electrochemical biosensor for multiple exosome surface proteins analysis.	In the study, we developed an electrochemical biosensor based on MXenes-Au NPs modification to assess the differential expression of EGFR, CEA, and EpCAM proteins of exosomes.
37562522	Identification of CD147-positive extracellular vesicles as novel non-invasive biomarkers for the diagnosis and prognosis of colorectal cancer.	No abstract available
37607449	A filter-electrochemical microfluidic chip for multiple surface protein analysis of exosomes to detect and classify breast cancer.	The approach demonstrated that the utilization of BC exosome-associated tumor biomarkers (i.e., PMSA, EGFR, CD81, and CEA), enabled the classification of various BC mouse models samples and clinical BC samples.