Protein detail
CLD12
Claudin-12
Entry name CLD12 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count 4 | Protein classification Predicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Claudin-12
Protein Class
Predicted membrane proteins
Transmembrane
11..31; Helical; 88..108; Helical; 136..156; Helical; 175..195; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Description
Claudin 12
Chromosome
7
Position
90383721-90513402
Supporting publications (n)
4
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificesophagusBrain Regional Specificchoroid plexusCell SpecificBreast secretory cellsBlood Cell SpecificeosinophilBlood Lineage Specificdendritic cells
Function & Pathway
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
KEGG (7)
Reactome (3)
Canonical Pathways (3)
- M290 Pid il12 stat4 pathway
- M88 Pid cd8 tcr pathway
- M34 Pid tcr pathway
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence26
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| transmembrane | transmembrane_predicted | Phobius | Yes |
Page 3 of 3Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
244
Mass
27,110
Sequence
MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT
Domain & Motif Annotations
Protein Families
Claudin family
Sequence Similarities
Belongs to the claudin family.
Clinical Relevance
Antibody
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 19837982 | Proteomics analysis of A33 immunoaffinity-purified exosomes released from the human colon tumor cell line LIM1215 reveals a tissue-specific protein signature. | A conspicuous finding of this comparative analysis was the presence of host cell-specific (LIM1215 exosome) proteins such as A33, cadherin-17, carcinoembryonic antigen, epithelial cell surface antigen (EpCAM), proliferating cell nuclear antigen, epidermal growth factor receptor, mucin 13, misshapen-like kinase 1, keratin 18, mitogen-activated protein kinase 4, claudins (1, 3, and 7), centrosomal protein 55 kDa, and ephrin-B1 and -B2. Here, we describe an immunoaffinity capture method using the colon epithelial cell-specific A33 antibody to purify colorectal cancer cell (LIM1215)-derived exosomes. |
| 37352782 | MXenes-Au NPs modified electrochemical biosensor for multiple exosome surface proteins analysis. | In the study, we developed an electrochemical biosensor based on MXenes-Au NPs modification to assess the differential expression of EGFR, CEA, and EpCAM proteins of exosomes. |
| 37562522 | Identification of CD147-positive extracellular vesicles as novel non-invasive biomarkers for the diagnosis and prognosis of colorectal cancer. | Identification of CD147-positive extracellular vesicles as novel non-invasive biomarkers for the diagnosis and prognosis of colorectal cancer. |
| 37607449 | A filter-electrochemical microfluidic chip for multiple surface protein analysis of exosomes to detect and classify breast cancer. | The approach demonstrated that the utilization of BC exosome-associated tumor biomarkers (i.e., PMSA, EGFR, CD81, and CEA), enabled the classification of various BC mouse models samples and clinical BC samples. |