Protein detail

BCAR1

Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)

Entry name BCAR1	UniProt ID P56945	EVMP score 0.38
Frequency 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)

Protein Class

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000050820

Entrez Gene Symbol

BCAR1

Gene Synonym

CASCASS1CrkasP130Cas

Gene Description

BCAR1 scaffold protein, Cas family member

Chromosome

Position

75228181-75268053

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificadipose tissueCell SpecificMicrogliaSingle-Nuclei Brain Specificcentral nervous system macrophageSecretome LocationSecreted to extracellular matrixSecretome FunctionDevelopmental protein

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Canonical Pathways

M77 Pid wnt signaling pathway
M266 Pid ncadherin pathway
M5493 Wnt signaling

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

77 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
BCAR1	PTK2	Q05397	Y	710	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
BCAR1	PTK2	Q05397	Y	653	phosphorylation	KEA	KEA:12972425 KEA:8670206 KEA:12480533 KEA:11604500
BCAR1	CASP3	P42574	D	318	cleavage	HPRD	HPRD:10712510
BCAR1	CASP3	P42574	D	650	cleavage	HPRD	HPRD:10712510
BCAR1	EGFR	P00533	Y	664	phosphorylation	Li2012KEA	KEA:17570479
BCAR1	EGFR	P00533	Y	327	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:15951569
BCAR1	INSR	P06213	Y	653	phosphorylation	Li2012
BCAR1	BMX	P51813	Y	12	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
BCAR1	PTK2B	Q14289	Y	165	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:19086031
BCAR1	PTK2B	Q14289	Y	249	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:19086031

Page 7 of 8Previous Next

Ligand-Receptor Signaling

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
adhesion_cytoskeleton_adaptor	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No

Regulatory Interaction Network

13 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTN14	Q15678	BCAR1	P56945	Yes	No	Yes	SIGNOR_ProtMapperREACH_ProtMapperSIGNORProtMapper	ProtMapper:22710723 SIGNOR:22710723
BMX	P51813	BCAR1	P56945	Yes	Yes	No	iPTMnetSIGNORProtMapperInnateDBPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:21937722 InnateDB:15207703 SIGNOR:21937722
BCAR1	P56945	P85A	P27986	Yes	Yes	No	HPRDWangSIGNOR	HPRD:10799562 SIGNOR:27447856

Page 2 of 2Previous

Protein Complex Composition

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
FAK\u2013p130Cas\u2013MT1 complex	BCAR1 MMP14 PTK2	P50281 P56945 Q05397	0:0:0	CORUM	CORUM:6921	22291036
HT_SC_Cluster41	BCAR1 PHB1 PHB2	P35232 P56945 Q99623	1:1:1	Compleat	Compleat:HC3492
NPHP1-NPHP4-BCAR1 complex	BCAR1 NPHP1 NPHP4	O15259 O75161 P56945	0:0:0	CORUM	CORUM:6381	15661758
	ARCN1 ARF4 ATP9A BCAR1 PDE6D RHBDD3 SCPEP1 SFT2D2 SLC66A2 TM9SF4 UBC ZDHHC13	O43924 O75110 O95562 P0CG48 P18085 P48444 P56945 Q8IUH4 Q8N2U9 Q92544 Q9HB40 Q9Y3P4	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4577
	ARCN1 ARF4 BCAR1 GOLT1B PDE6D RHBDD3 SCPEP1 SFT2D3 SLC66A2 TM9SF4 UBC ZDHHC13	O43924 P0CG48 P18085 P48444 P56945 Q587I9 Q8IUH4 Q8N2U9 Q92544 Q9HB40 Q9Y3E0 Q9Y3P4	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3877
	ARCN1 ARF4 BCAR1 PDE6D RGP1 RHBDD3 SCPEP1 SFT2D1 SLC66A2 TM9SF4 UBC ZDHHC13	O43924 P0CG48 P18085 P48444 P56945 Q8IUH4 Q8N2U9 Q8WV19 Q92544 Q92546 Q9HB40 Q9Y3P4	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6145
	ARCN1 BCAR1 GOLT1B PDE6D RHBDD3 SCPEP1 SFT2D1 SLC66A2 TM9SF4 TRIM23 UBC ZDHHC12	O43924 P0CG48 P36406 P48444 P56945 Q8N2U9 Q8WV19 Q92544 Q96GR4 Q9HB40 Q9Y3E0 Q9Y3P4	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6282
	BCAR1	P56945	2	PDB	PDB:1wyx
	BCAR1 SH2D3C	P56945 Q8N5H7	2:2	PDB	PDB:3t6g

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationMicrofluidics-Based Methods	Mass spectrometry	1	40545963

Sequence, Structure & Domains

Sequences

Length

870

Mass

93,372

Sequence

MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA

Alternative Products

Event=Alternative splicing; Named isoforms=8; Name=1; IsoId=P56945-1; Sequence=Displayed; Name=2; IsoId=P56945-2; Sequence=VSP_043559; Name=3; IsoId=P56945-3; Sequence=VSP_045355; Name=4; IsoId=P56945-4; Sequence=VSP_046127, VSP_046128; Name=5; IsoId=P56945-5; Sequence=VSP_046748; Name=6; IsoId=P56945-6; Sequence=VSP_046749; Name=7; IsoId=P56945-7; Sequence=VSP_046750; Name=8; IsoId=P56945-8; Sequence=VSP_046751

Alternative Sequence

1..4; MNHL -> MLTHRPQEAEQRGRTPGPSFEW (in isoform 2); 1..4; MNHL -> MQGK (in isoform 4); 1..4; MNHL -> ME (in isoform 5); 1..4; MNHL -> MPAKPFLSSVLLSWKVLDFSGPGPQGTGQPCSCGHWAEGQGGPPEPAGGP (in isoform 6); 1..4; MNHL -> MHCPGEAPLAAPRPTPKDPCLR (in isoform 7); 1..4; MNHL -> MSVP (in isoform 8); 64..211; Missing (in isoform 4); 304; A -> AVSKCQGNARARLRLWGVW (in isoform 3)

3D Structural Models

Helix

37..39; 57..59; 740..770; 775..801; 806..835; 840..870

Beta Strand

5..12; 29..34; 43..48; 51..56; 60..68

3D Structure

NMR spectroscopy (3); X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

73..85; Pro residues; 97..111; Polar residues; 135..151; Polar residues; 416..426; Basic and acidic residues; 427..444; Low complexity; 626..655; Polar residues

Motif

635..643; SH3-binding

Domain (CC)

Contains a central domain (substrate domain) containing multiple potential SH2-binding sites and a C-terminal domain containing a divergent helix-loop-helix (HLH) motif. The SH2-binding sites putatively bind CRK, NCK and ABL1 SH2 domains. The HLH motif is absolutely required for the induction of pseudohyphal growth in yeast and mediates heterodimerization with NEDD9 (By similarity).; DOMAIN: A serine-rich region promotes activation of the serum response element (SRE).; DOMAIN: The SH3 domain is necessary for the localization of the protein to focal adhesions and interacts with one proline-rich region of PTK2/FAK11.

Domain (FT)

3..65; SH3

Region

70..156; Disordered; 115..416; Substrate for kinases; 411..449; Disordered; 609..658; Disordered; 715..734; Disordered; 746..796; Divergent helix-loop-helix motif

Protein Families

CAS family

Sequence Similarities

Belongs to the CAS family.

Clinical Relevance

Disease Involvement

Diabetes mellitus

Drugs

CELECOXIB

Antibody

CAB000443 HPA042282 HPA063796

Interaction Protein

ENSG00000010810ENSG00000061938ENSG00000095370ENSG00000108953ENSG00000125731ENSG00000126603ENSG00000127947ENSG00000128245ENSG00000136205ENSG00000137936ENSG00000164924ENSG00000166913ENSG00000167193ENSG00000169398ENSG00000170027ENSG00000196396ENSG00000197122ENSG00000241685ENSG00000277363

Interaction Count

Interaction Dataset

intact_biogridbiogrid_opencellbiogrid_bioplexbiogrid_opencell_bioplex