Protein detail
BCAR1
Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)
Entry name BCAR1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CASCASS1CrkasP130Cas
Gene Description
BCAR1 scaffold protein, Cas family member
Chromosome
16
Position
75228181-75268053
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificadipose tissueCell SpecificMicrogliaSingle-Nuclei Brain Specificcentral nervous system macrophageSecretome LocationSecreted to extracellular matrixSecretome FunctionDevelopmental protein
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (8)
Molecular Function (3)
Biological Process (3)
KEGG (12)
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04148 Efferocytosis
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04670 Leukocyte transendothelial migration
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04935 Growth hormone synthesis, secretion and action
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05131 Shigellosis
Page 1 of 2
Reactome (11)
- R-hsa-186763 downstream signal transduction
- R-hsa-109582 hemostasis
- R-hsa-354192 integrin signaling
- R-hsa-372708 p130cas linkage to mapk signaling for integrins
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-76009 platelet aggregation plug formation
- R-hsa-8849471 ptk6 regulates rho gtpases ras gtpase and map kinases
- R-hsa-186797 signaling by pdgf
- R-hsa-8848021 signaling by ptk6
- R-hsa-9006934 signaling by receptor tyrosine kinases
Page 1 of 2
Canonical Pathways (3)
- M77 Pid wnt signaling pathway
- M266 Pid ncadherin pathway
- M5493 Wnt signaling
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence107
Enzyme-Mediated Modification (77)
77 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| BCAR1 | EGF | P01133 | Y | 128 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:27240404ProtMapper:22710723 |
| BCAR1 | EGF | P01133 | Y | 410 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:23109808 |
| BCAR1 | CSK | P41240 | Y | 128 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:24962474 |
| BCAR1 | BTK | Q06187 | Y | 410 | phosphorylation | KEA | KEA:17570479 |
| BCAR1 | IGF1R | P08069 | Y | 653 | phosphorylation | KEA | KEA:17570479 |
| BCAR1 | ITK | Q08881 | Y | 128 | phosphorylation | KEA | KEA:17570479 |
| BCAR1 | ITK | Q08881 | Y | 249 | phosphorylation | KEA | KEA:17570479 |
Page 8 of 8Previous
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| adhesion_cytoskeleton_adaptor | intracellular_intercellular_related | Adhesome | Yes | ||||
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes |
Regulatory Interaction Network (13)
13 records.
Page 1 of 2Next
Protein Complex Composition (9)
9 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationMicrofluidics-Based Methods | Mass spectrometry | 1 | 40545963 |
Sequence, Structure & Domains
Sequences
Length
870
Mass
93,372
Sequence
MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA
Alternative Products
Event=Alternative splicing; Named isoforms=8; Name=1; IsoId=P56945-1; Sequence=Displayed; Name=2; IsoId=P56945-2; Sequence=VSP_043559; Name=3; IsoId=P56945-3; Sequence=VSP_045355; Name=4; IsoId=P56945-4; Sequence=VSP_046127, VSP_046128; Name=5; IsoId=P56945-5; Sequence=VSP_046748; Name=6; IsoId=P56945-6; Sequence=VSP_046749; Name=7; IsoId=P56945-7; Sequence=VSP_046750; Name=8; IsoId=P56945-8; Sequence=VSP_046751
Alternative Sequence
1..4; MNHL -> MLTHRPQEAEQRGRTPGPSFEW (in isoform 2); 1..4; MNHL -> MQGK (in isoform 4); 1..4; MNHL -> ME (in isoform 5); 1..4; MNHL -> MPAKPFLSSVLLSWKVLDFSGPGPQGTGQPCSCGHWAEGQGGPPEPAGGP (in isoform 6); 1..4; MNHL -> MHCPGEAPLAAPRPTPKDPCLR (in isoform 7); 1..4; MNHL -> MSVP (in isoform 8); 64..211; Missing (in isoform 4); 304; A -> AVSKCQGNARARLRLWGVW (in isoform 3)
3D Structural Models
Helix
37..39; 57..59; 740..770; 775..801; 806..835; 840..870
Beta Strand
5..12; 29..34; 43..48; 51..56; 60..68
3D Structure
NMR spectroscopy (3); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
73..85; Pro residues; 97..111; Polar residues; 135..151; Polar residues; 416..426; Basic and acidic residues; 427..444; Low complexity; 626..655; Polar residues
Motif
635..643; SH3-binding
Domain (CC)
Contains a central domain (substrate domain) containing multiple potential SH2-binding sites and a C-terminal domain containing a divergent helix-loop-helix (HLH) motif. The SH2-binding sites putatively bind CRK, NCK and ABL1 SH2 domains. The HLH motif is absolutely required for the induction of pseudohyphal growth in yeast and mediates heterodimerization with NEDD9 (By similarity).; DOMAIN: A serine-rich region promotes activation of the serum response element (SRE).; DOMAIN: The SH3 domain is necessary for the localization of the protein to focal adhesions and interacts with one proline-rich region of PTK2/FAK11.
Domain (FT)
3..65; SH3
Region
70..156; Disordered; 115..416; Substrate for kinases; 411..449; Disordered; 609..658; Disordered; 715..734; Disordered; 746..796; Divergent helix-loop-helix motif
Protein Families
CAS family
Sequence Similarities
Belongs to the CAS family.
Clinical Relevance
Disease Involvement
Diabetes mellitus
Related Diseases
Drugs
Interaction Protein (19)
ENSG00000010810ENSG00000061938ENSG00000095370ENSG00000108953ENSG00000125731ENSG00000126603ENSG00000127947ENSG00000128245ENSG00000136205ENSG00000137936ENSG00000164924ENSG00000166913ENSG00000167193ENSG00000169398ENSG00000170027ENSG00000196396ENSG00000197122ENSG00000241685ENSG00000277363
Interaction Count
19
Interaction Dataset (4)
intact_biogridbiogrid_opencellbiogrid_bioplexbiogrid_opencell_bioplex
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 30875722 | Human Heart Explant-Derived Extracellular Vesicles: Characterization and Effects on the In Vitro Recellularization of Decellularized Heart Valves. | No related sentences available |