Protein detail

JAM2

Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)

Entry name JAM2	UniProt ID P57087	EVMP confidence score 0.63
Supporting publications (n) 6	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)

Protein Function (3)

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
CD markers

Transmembrane

239..259; Helical

Transmembrane Count

Ensembl

ENSG00000154721

Entrez Gene Symbol

JAM2

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization2

Cell SpecificCardiomyocytes

Function & Pathway8

Protein Function (3)

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
CD markers

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

KEGG (5)

Reactome (4)

Canonical Pathways (3)

M290 Pid il12 stat4 pathway
M88 Pid cd8 tcr pathway
M34 Pid tcr pathway

Mediation Categories (2)

Fusion and delivery mediationImmune mediation

Relations & Evidence43

Ligand-Receptor Signaling (41)

41 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No
cell_surface	cell_surface	connectomeDB2020	No	No	No	Yes	No
cell_surface	cell_surface	Baccin2019	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
ligand	ligand	CellCall	Yes	No	No	Yes	No
ligand	ligand	ICELLNET	Yes	No	No	Yes	No
cell_adhesion	ligand	ICELLNET	Yes	No	No	Yes	No
ligand	ligand	OmniPath	Yes	No	No	Yes	No

Page 4 of 5Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	JAM2 JAM3 TJP1	P57087 Q07157 Q9BX67	1:1:1	CompleatCFinder	Compleat:HC4465

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	36347401 37154070

Sequence, Structure & Domains9

Sequences

Length

298

Mass

33,207

Sequence

MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P57087-1; Sequence=Displayed; Name=2; IsoId=P57087-2; Sequence=VSP_045153; Name=3; IsoId=P57087-3; Sequence=VSP_047352

Alternative Sequence

44..79; Missing (in isoform 2); 289..298; DFKHTKSFII -> VQWLTPVIPALWKAAAGGSRGQEF (in isoform 3)

Domain & Motif Annotations

Domain (CC)

The Ig-like V-type domain is necessary and sufficient to mediate interaction with JAM3 and integrin alpha-4/beta-1..

Domain (FT)

32..127; Ig-like V-type; 134..238; Ig-like C2-type

Protein Families

Immunoglobulin superfamily

Sequence Similarities

Belongs to the immunoglobulin superfamily.

Supporting Publications6

PMID	Title	Abstract
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
40730843	Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available