Protein detail

SNX16

Sorting nexin-16

Entry name SNX16	UniProt ID P57768	EVMP confidence score 0.50
Supporting publications (n) 4	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Sorting nexin-16

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000104497

Entrez Gene Symbol

SNX16

Gene Description

Sorting nexin 16

Chromosome

Position

81799581-81842866

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence10

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
SNX16	P57768	6	PDB	PDB:5gw0PDB:5gw1
KIF6 SNX16	P57768 Q6ZMV9	0:0	hu.MAP2
HEATR5A KIF6 SNX16	P57768 Q6ZMV9 Q86XA9	0:0:0	hu.MAP2
FEZ2 HEATR5A KIF6 SNX16	P57768 Q6ZMV9 Q86XA9 Q9UHY8	0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	5	38207106 38113368 40189497 41307968 38207106

Sequence, Structure & Domains15

Sequences

Length

344

Mass

39,167

Sequence

MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P57768-1; Sequence=Displayed; Name=2; IsoId=P57768-2; Sequence=VSP_042944

Alternative Sequence

126..154; Missing (in isoform 2)

3D Structural Models

Helix

145..158; 178..197; 199..202; 205..211; 222..229; 233..276

Beta Strand

108..136; 138..144; 160..162; 171..173; 213..215

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

1..10; Pro residues; 14..26; Polar residues; 27..40; Low complexity; 41..66; Polar residues

Coiled Coil

223..278

Domain (CC)

The PX domain mediates interaction with membranes enriched in phosphatidylinositol 3-phosphate.

Domain (FT)

105..218; PX

Region

1..66; Disordered; 81..107; Disordered

Protein Families

Sorting nexin family

Sequence Similarities

Belongs to the sorting nexin family.

Clinical Relevance1

Antibody (3)

HPA024730 HPA024731 HPA024817

Supporting Publications3

PMID	Title	Abstract
31508500	Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping.	No abstract available
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No abstract available
37922300	Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women.	No abstract available