Protein detail
GBG2
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (G gamma-I)
Entry name GBG2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Predicted intracellular proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 (G gamma-I)
Protein Class (2)
Predicted intracellular proteinsRAS pathway related proteins
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Description
G protein subunit gamma 2
Chromosome
14
Position
51826195-51979342
Supporting publications (n)
4
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecifictestisCell SpecificAdrenal cortex cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function (2)
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (5)
Molecular Function (2)
Biological Process (3)
KEGG (20)
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
Page 1 of 2
Reactome (56)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
Page 1 of 6
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence13
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (7)
7 records.
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| 1 | 32384937 |
Sequence, Structure & Domains
Sequences
Length
71
Mass
7,850
Sequence
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
3D Structural Models
Turn
24..26; 49..51; 56..58; 63..66
Helix
9..23; 30..44; 45..47; 60..62
3D Structure
Electron microscopy (951); X-ray crystallography (16)
Domain & Motif Annotations
Protein Families
G protein gamma family
Sequence Similarities
Belongs to the G protein gamma family.
Clinical Relevance
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 26775013 | Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers. | No related sentences available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No related sentences available |
| 37862381 | Surfaceome analysis of extracellular vesicles from senescent cells uncovers uptake repressor DPP4. | Surfaceome analysis of extracellular vesicles from senescent cells uncovers uptake repressor DPP4. |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |