Protein detail
CD81
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Entry name CD81 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 305 | Transmembrane count 4 | Protein classification CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Protein Class (7)
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- CD markers
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Transmembrane
13..33; Helical; 64..84; Helical; 90..112; Helical; 202..224; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
TAPA-1TAPA1TSPAN28
Gene Description
CD81 molecule
Chromosome
11
Position
2376177-2397802
Supporting publications (n)
305
EVMP confidence score
0.88
Fluorescence & Localization
Tissue Specificheart muscleCell SpecificCardiomyocytesBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway
Protein Function (5)
- CD markers
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (9)
Molecular Function (7)
Biological Process (3)
KEGG (4)
Reactome (4)
Canonical Pathways
M13 Pid erbb4 pathway
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence44
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
236
Mass
25,809
Sequence
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
3D Structural Models
Helix
10..36; 57..80; 81..84; 113..115; 116..136; 141..154; 163..165; 166..171; 172..174; 181..185; 190..199; 202..230
Beta Strand
158..160
3D Structure
Electron microscopy (1); X-ray crystallography (15)
Domain & Motif Annotations
Domain (CC)
Binds cholesterol in a cavity lined by the transmembrane spans.
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Supporting Publications305
| PMID | Title | Related sentences |
|---|---|---|
| 25732677 | Heparanase activates the syndecan-syntenin-ALIX exosome pathway. | Conversely, reduction of endogenous heparanase reduces the secretion of syntenin-1-containing exosomes. Here we investigated the role of heparanase, the only mammalian enzyme able to cleave heparan sulfate internally, in the syndecan-syntenin-ALIX exosome biogenesis pathway. Taken together, our findings identify heparanase as a modulator of the syndecan-syntenin-ALIX pathway, fostering endosomal membrane budding and the biogenesis of exosomes by trimming the heparan sulfate chains on syndecans. The ability of heparanase to stimulate exosome production depends on syntenin-1 and ALIX. We recently showed that the syndecan heparan sulfate proteoglycans control the biogenesis of exosomes through their interaction with syntenin-1 and the endosomal-sorting complex required for transport accessory component ALIX. |
| 25735706 | Exosomal proteins as potential diagnostic markers in advanced non-small cell lung carcinoma. | The array contained 37 antibodies targeting lung cancer-related proteins and was used to capture exosomes, which were visualised with a cocktail of biotin-conjugated CD9, CD63 and CD81 antibodies. |
| 25824442 | Cardiosome mediated regulation of MMP9 in diabetic heart: role of mir29b and mir455 in exercise. | Use of exosomal markers CD81, Flottilin 1, and acetylcholinesterase activity in the isolated exosomes confirmed enhanced exosomal release in the exercise group. |
| 25881934 | Plasma exosomes protect the myocardium from ischemia-reperfusion injury. | RESULTS: Exosomes exhibited the expected size and expressed marker proteins CD63, CD81, and heat shock protein (HSP) 70. |
| 25890246 | Highly-purified exosomes and shed microvesicles isolated from the human colon cancer cell line LIM1863 by sequential centrifugal ultrafiltration are biochemically and functionally distinct. | Western blot analysis showed Fn5 (SCUF-Exos) contained traditional exosome marker proteins (Alix(+), TSG101(+), CD81(+), CD63(+)), while Fn1 (SCUF-sMVs) lacked these protein markers. |
| 25955720 | Muscle Releases Alpha-Sarcoglycan Positive Extracellular Vesicles Carrying miRNAs in the Bloodstream. | No related sentences available |
| 26062630 | Altered lysosomal proteins in neural-derived plasma exosomes in preclinical Alzheimer disease. | METHODS: Blood exosomes obtained once from patients with AD (n = 26) or frontotemporal dementia (n = 16), other patients with AD (n = 20) both when cognitively normal and 1 to 10 years later when diagnosed, and case controls were enriched for neural sources by anti-human L1CAM antibody immunoabsorption. |
| 26447809 | Extracellular Vesicles from Caveolin-Enriched Microdomains Regulate Hyaluronan-Mediated Sustained Vascular Integrity. | Extracellular Vesicles from Caveolin-Enriched Microdomains Regulate Hyaluronan-Mediated Sustained Vascular Integrity. Our results indicate that long-term (6-24 hours) exposure of HMW-HA induced release of a novel type of extracellular vesicle from HLMVEC called enlargeosomes (characterized by AHNAK expression) while LMW-HA long-term exposure promoted release of exosomes (characterized by CD9, CD63, and CD81 expression). |
| 26754424 | MSC surface markers (CD44, CD73, and CD90) can identify human MSC-derived extracellular vesicles by conventional flow cytometry. | MSC surface markers (CD44, CD73, and CD90) can identify human MSC-derived extracellular vesicles by conventional flow cytometry. |
| 26873936 | Human plasma platelet-derived exosomes: effects of aspirin. | Aspirin consumption significantly blocked thrombin- and collagen-induced increases in exosome cargo levels of chemokines and HMGB1, without altering total exosome secretion or GPVI cargo. Exosome secretion by purified platelets in vitro did not increase after exposure to thrombin or collagen, as assessed by exosome counts and quantification of the CD81exosome marker. The plasma platelet-derived exosome number is lower and its chemokine and HMGB1 levels higher after age 65 yr. Aspirin consumption significantly suppressed cargo protein levels of plasma platelet-derived exosomes without altering total levels of exosomes. Thrombin and collagen increased exosome content of \xce\xb1-granule chemokines CXCL4 and CXCL7 and cytoplasmic high-mobility group box 1 (HMGB1) protein, but not membrane platelet glycoprotein VI (GPVI), with dependence on extracellular calcium. |