Protein detail

CD81

CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)

Entry name
CD81
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
305
Transmembrane count
4
Protein classification
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Basic Information
Protein Names
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Protein Class (7)
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
  • CD markers
  • Potential drug targets
  • Human disease related genes:Immune system diseases:Primary immunodeficiency
  • Transporters:Accessory Factors Involved in Transport
  • Disease related genes
Transmembrane
13..33; Helical; 64..84; Helical; 90..112; Helical; 202..224; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (3)
TAPA-1TAPA1TSPAN28
Gene Description
CD81 molecule
Chromosome
11
Position
2376177-2397802
Supporting publications (n)
305
EVMP confidence score
0.88
Fluorescence & Localization
CD81 fluorescence
Tissue Specificheart muscleCell SpecificCardiomyocytesBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway
Relations & Evidence44

Ligand-Receptor Signaling (41)

41 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembranetransmembrane_predictedPhobiusYes
Page 5 of 5Previous

Protein Complex Composition (2)

2 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
CD81CTSCP53634P600330:0Havugimana2012Havugimana2012:C_97
CD81P600332PDBPDB:5dfvPDB:6ejmPDB:3x0ePDB:5m3dPDB:5m3tPDB:5m2cPDB:6ejgPDB:5m33PDB:1g8qPDB:6ek2PDB:1iv5PDB:6u9sPDB:5m4r

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Mass spectrometry [LTQ-FT Ultra]Mass spectrometry0
Sequence, Structure & Domains

Sequences

Length
236
Mass
25,809
Sequence
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

3D Structural Models

Helix
10..36; 57..80; 81..84; 113..115; 116..136; 141..154; 163..165; 166..171; 172..174; 181..185; 190..199; 202..230
Beta Strand
158..160
3D Structure
Electron microscopy (1); X-ray crystallography (15)

Domain & Motif Annotations

Domain (CC)
Binds cholesterol in a cavity lined by the transmembrane spans.
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Antibody (2)
Interaction Protein (3)
ENSG00000010278ENSG00000078369ENSG00000134247
Interaction Count
3
Interaction Dataset
biogrid_opencell
Supporting Publications305
PMIDTitleRelated sentences
34907674Bone marrow-mesenchymal stem cell-derived extracellular vesicles affect proliferation and apoptosis of leukemia cells in vitro.The isolated MSC-EVs were comprised of microvesicles and exosomes, as examined by the size of vesicles and exosomal proteins, CD81 and flotillin-1.
34947800Nanostructured Modifications of Titanium Surfaces Improve Vascular Regenerative Properties of Exosomes Derived from Mesenchymal Stem Cells: Preliminary In Vitro Results.Nanomodifications of Ti surfaces significantly improved the release of hMSCs exosomes, having dimensions below 100 nm and expressing CD63 and CD81 surface markers.
34965880Circulating extracellular vesicles activate the pyroptosis pathway in the brain following ventilation-induced lung injury.Isolated EVs were enriched for the exosomal markers CD9 and CD81, suggesting enrichment for exosomes.
35053007Proteomic Analysis of Exosomes Secreted from Human Alpha-1 Antitrypsin Overexpressing Mesenchymal Stromal Cells.Both MSCs and hAAT-MSCs expressed exosome-associated proteins, including CD63, CD81, and CD9. However, there were differences between exosomes from control MSCs and hAAT-MSCs in cytokine signaling of the immune system, stem cell differentiation, and carbohydrate metabolism ( Proteomic Analysis of Exosomes Secreted from Human Alpha-1 Antitrypsin Overexpressing Mesenchymal Stromal Cells.
35069505Proteomics Analysis of Exosomes From Patients With Active Tuberculosis Reveals Infection Profiles and Potential Biomarkers.Among these proteins heat shock protein70 (HSP70), CD81, major histocompatibility complex-I (MHC-I ) and tumor susceptibility gene101 (TSG101) were present in exosomes of ATB and normal individuals confirmed via western blotting. In addition, among identified exosomal proteins lipopolysaccharide binding protein (LBP) increased significantly, but CD36 and MHC-I decreased significantly in ATB exosomes.
35195427Drug Loading and Functional Efficacy of Cow, Buffalo, and Goat Milk-Derived Exosomes: A Comparative Study.The isolated exosomes were found to be spherical with a size of <200 nm and displayed specific markers, namely, CD81, HSP70, HSC70, and miRNAs.
35234046CD14-positive extracellular vesicles in bronchoalveolar lavage fluid as a new biomarker of acute respiratory distress syndrome.CD14-positive extracellular vesicles in bronchoalveolar lavage fluid as a new biomarker of acute respiratory distress syndrome.
35249136CD5L Secreted by Macrophage on Atherosclerosis Progression Based on Lipid Metabolism Induced Inflammatory Damage.Atherosclerosis cell models were established by transwell and separated into three groups: first group was treated with exosome inhibitor (GW4869), second group was injected with CD5L protein and third group was model control. Morphological properties of exosomes were identified by transmission electron microscopy, and the marker proteins CD63 and CD81 of exosomes were measured by Western blot.
35259607Kinetics and interaction studies of anti-tetraspanin antibodies and ICAM-1 with extracellular vesicle subpopulations using continuous flow quartz crystal microbalance biosensor.Continuous flow quartz crystal microbalance (QCM) was utilized to study binding kinetics between EV subpopulations (exomere- and exosome-sized EVs) and four affinity ligands: monoclonal antibodies against tetraspanins (anti-CD9, anti-CD63, and anti-CD81) and recombinant intercellular adhesion molecule-1 (ICAM-1) or CD54 protein).
35260179A novel protein encoded by circHNRNPU promotes multiple myeloma progression by regulating the bone marrow microenvironment and alternative splicing.Exosomes were isolated from the culture supernatant of MM cells by ultracentrifugation and characterized by Transmission Electron Microscope and WB confirmation of exosomes markers Alix and CD9.
Page 21 of 31PreviousNext