Protein detail

CD81

CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)

Entry name
CD81
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
305
Transmembrane count
4
Protein classification
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information13
Protein Names
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Protein Class (7)
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
  • CD markers
  • Potential drug targets
  • Human disease related genes:Immune system diseases:Primary immunodeficiency
  • Transporters:Accessory Factors Involved in Transport
  • Disease related genes
Transmembrane
13..33; Helical; 64..84; Helical; 90..112; Helical; 202..224; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (3)
TAPA-1TAPA1TSPAN28
Gene Description
CD81 molecule
Chromosome
11
Position
2376177-2397802
Supporting publications (n)
305
EVMP confidence score
0.88
Fluorescence & Localization7
CD81 fluorescence
Tissue Specificheart muscleCell SpecificCardiomyocytesBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway8
Relations & Evidence44

Ligand-Receptor Signaling (41)

41 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembranetransmembrane_predictedPhobiusNoNoNoYesNo
Page 5 of 5Previous

Protein Complex Composition (2)

2 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
CD81CTSCP53634P600330:0Havugimana2012Havugimana2012:C_97
CD81P600332PDBPDB:5dfvPDB:6ejmPDB:3x0ePDB:5m3dPDB:5m3tPDB:5m2cPDB:6ejgPDB:5m33PDB:1g8qPDB:6ek2PDB:1iv5PDB:6u9sPDB:5m4r

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Mass spectrometry [LTQ-FT Ultra]Mass spectrometry0
Sequence, Structure & Domains9

Sequences

Length
236
Mass
25,809
Sequence
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

3D Structural Models

Helix
10..36; 57..80; 81..84; 113..115; 116..136; 141..154; 163..165; 166..171; 172..174; 181..185; 190..199; 202..230
Beta Strand
158..160
3D Structure
Electron microscopy (1); X-ray crystallography (15)

Domain & Motif Annotations

Domain (CC)
Binds cholesterol in a cavity lined by the transmembrane spans.
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance4
Interaction Protein (3)
ENSG00000010278ENSG00000078369ENSG00000134247
Interaction Count
3
Interaction Dataset
biogrid_opencell
Supporting Publications305
PMIDTitleAbstract
28643872Circulating microRNA as candidates for early embryonic viability in cattle.Extracellular vesicles from Day 17 and 24 samples were isolated from serum using ultra-centrifugation, and their presence was confirmed by nanoparticle tracking and Western blot analyses (for CD81) prior to RNA extraction.
28694142Increased PSA expression on prostate cancer exosomes in in vitro condition and in cancer patients.The results show that microenvironmental acidity induces an increased release of nanovesicles expressing both PSA and the exosome marker CD81.
28840975Cardioprotection mediated by exosomes is impaired in the setting of type II diabetes but can be rescued by the use of non-diabetic exosomes in vitro.CD81 and HSP70 exosome markers were increased in diabetic rat exosomes.
28847700The HBx gene of hepatitis B virus can influence hepatic microenvironment via exosomes by transferring its mRNA and protein.Here, we show that HBx can tweak the exosome biogenesis machinery both by enhancing neutral sphingomyelinase2 activity as well as by interacting with exosomal biomarkers such as neutral sphingomyelinase2, CD9 and CD81. The nano particle tracking analysis revealed enhanced secretion of exosomes by the HBx-expressing cells while confocal studies confirmed the co-localization of HBx with CD9 and CD63.
28878075Characterization of the Quasi-Enveloped Hepatitis E Virus Particles Released by the Cellular Exosomal Pathway.Purified CD63-, CD9-, or CD81-positive exosomes derived from the culture supernatants of HEV-infected cells that had been cultivated in serum-free medium were found to contain HEV RNA and the viral capsid (ORF2) and ORF3 proteins, as determined by reverse transcription-PCR (RT-PCR) and Western blotting, respectively.
28934733Exosomes from Human-Induced Pluripotent Stem Cell-Derived Mesenchymal Stromal Cells (hiPSC-MSCs) Protect Liver against Hepatic Ischemia/ Reperfusion Injury via Activating Sphingosine Kinase and Sphingosine-1-Phosphate Signaling Pathway.hiPSC-MSCs-Exo had diameters ranging from 100 to 200 nm and expressed exosome markers (Alix, CD63 and CD81).
29116068[Hydrogel microchip as a tool for studying exosomes in human serum].Biochip-guided immunofluorescent analysis of the exosomes has made it possible for us to detect the A33 antigen and CD147 in the serum sample of the colorectal cancer patient with normal levels of CEA and CA19-9.
29336475Exosomes originating from MSCs stimulated with TGF-β and IFN-γ promote Treg differentiation.At the same time, the TGF-β, IFN-γ, IDO, and IL-10 content in exosomes was detected, and the influence of exosmes from defferent groups on the induction of mononuclear cell transformation into Tregs was analyzed via FCM. Common exosome markers, such as CD9, CD63, and CD81, were detected and analyzed by FCM. Our results show that the TGF-β combined with IFN-γ exosome group more effectively promoted the transformation of mononuclear cells to Tregs, and the analysis showed that IDO may play an important role.
29406582High complement levels in astrocyte-derived exosomes of Alzheimer disease.ADE levels of C1q, C4b, C3d, factor B, factor D, Bb, C3b, and C5b-C9 terminal complement complex, but not mannose-binding lectin, normalized by the CD81 exosome marker were significantly higher for AD patients (n = 28) than age- and gender-matched controls (all p < 0.0001).
29450143Purified horse milk exosomes contain an unpredictable small number of major proteins.Well-purified exosomes contained from five to eight different major proteins: CD81, CD63 receptors, beta-lactoglobulin and lactadherin were common to all preparations, while actin, butyrophilin, lactoferrin, and xanthine dehydrogenase were found only in some of them.
Page 8 of 31PreviousNext