Protein detail
CD81
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Entry name CD81 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 305 | Transmembrane count 4 | Protein classification CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Protein Class (7)
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- CD markers
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Transmembrane
13..33; Helical; 64..84; Helical; 90..112; Helical; 202..224; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
TAPA-1TAPA1TSPAN28
Gene Description
CD81 molecule
Chromosome
11
Position
2376177-2397802
Supporting publications (n)
305
EVMP confidence score
0.88
Fluorescence & Localization7
Tissue Specificheart muscleCell SpecificCardiomyocytesBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway8
Protein Function (5)
- CD markers
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (9)
Molecular Function (7)
Biological Process (3)
KEGG (4)
Reactome (4)
Canonical Pathways
M13 Pid erbb4 pathway
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence44
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| tetraspanins | receptor | HPMR | No | Yes | No | Yes | No |
| tet3 | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
Page 1 of 5Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 0 |
Sequence, Structure & Domains9
Sequences
Length
236
Mass
25,809
Sequence
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
3D Structural Models
Helix
10..36; 57..80; 81..84; 113..115; 116..136; 141..154; 163..165; 166..171; 172..174; 181..185; 190..199; 202..230
Beta Strand
158..160
3D Structure
Electron microscopy (1); X-ray crystallography (15)
Domain & Motif Annotations
Domain (CC)
Binds cholesterol in a cavity lined by the transmembrane spans.
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance4
Supporting Publications305
| PMID | Title | Abstract |
|---|---|---|
| 17949417 | Different types of in vitro generated human monocyte-derived dendritic cells release exosomes with distinct phenotypes. | In comparison to exosomes from conventional MDDCs, exosomes from IL-4/IL-3-generated MDDCs showed significantly stronger signals for HLA-ABC, HLA-DR, CD11c, CD63 and CD81. |
| 18945959 | Capture and transfer of HIV-1 particles by mature dendritic cells converges with the exosome-dissemination pathway. | Capture of HIV-1, HIV-1 Gag-enhanced green fluorescent protein (eGFP) viral-like particles (VLPs), and exosomes by DCs was up-regulated upon maturation, resulting in localization within a CD81(+) compartment. |
| 20124223 | Hypoxic tumor cell modulates its microenvironment to enhance angiogenic and metastatic potential by secretion of proteins and exosomes. | Ultracentrifugation at 100,000 x g precipitated 54% of the secreted proteins and enriched for many exosome-associated proteins such as the tetraspanins and Alix and also proteins with the potential to facilitate angiogenesis and metastasis. |
| 20138817 | Exosome secreted by MSC reduces myocardial ischemia/reperfusion injury. | They contained coimmunoprecipitating exosome-associated proteins, e.g., CD81, CD9, and Alix. |
| 20880880 | Proinflammatory exosomes in bronchoalveolar lavage fluid of patients with sarcoidosis. | Exosomes from patients showed significantly higher expression of MHC class I and II, tetraspanins CD9, CD63 and CD81 as well as neuregulin-1, known to be associated with cancer progression. |
| 21044087 | Exosomal-like vesicles with immune-modulatory features are present in human plasma and can induce CD4+ T-cell apoptosis in vitro. | Antibodies against exosomes FasL can block the activity of exosomes on CD4+ T-cell apoptosis. Moreover, three different concentrations of CD4+ T cells were inhibited by plasma exosomes and the suppressive function was not dependent on interleukin-2. RESULTS: Vesicles purified from human plasma displayed shapes and sizes similar to those of previously described exosomes and contained exosomes marker proteins CD63 and CD81. |
| 21172122 | RNA-containing exosomes in human nasal secretions. | Flow cytometry of exosomes using anti-major histocompatibility complex class II beads revealed exosomes positive for the tetraspanins CD9, CD63, and CD81. RESULTS: Exosomes were visualized as 40-80 nm, CD63(+) vesicles using EM. Western blot confirmed the presence of exosomal protein and absence of proteins from the endoplasmic reticulum (ER), because the exosomes were positive for Tsg101, but negative for the ER marker, calnexin. |
| 21235781 | Human saliva, plasma and breast milk exosomes contain RNA: uptake by macrophages. | Breast milk exosomes were further analysed for the presence of Hsc70, CD81 and calnexin by Western blot. Flow cytometry was performed by capturing the exosomes on anti-MHC class II coated beads, and further stain with anti-CD9, anti-CD63 or anti-CD81. |
| 21276792 | Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells. | Ion Trap mass spectrometry demonstrated the presence of exosome marker proteins (including CD81, Alix, cytoskeleton related proteins, and Rab family). |
| 22285593 | Comparison of ultracentrifugation, density gradient separation, and immunoaffinity capture methods for isolating human colon cancer cell line LIM1863-derived exosomes. | Notably, all isolations contained 40-100nm vesicles, and were positive for exosome markers (Alix, TSG101, HSP70) based on electron microscopy and Western blotting. Using the colorectal cancer cell line LIM1863 as a cell model, in this study we performed a comprehensive evaluation of current methods used for exosome isolation including ultracentrifugation (UC-Exos), OptiPrep™ density-based separation (DG-Exos), and immunoaffinity capture using anti-EpCAM coated magnetic beads (IAC-Exos). |