Protein detail
CD81
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Entry name CD81 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 305 | Transmembrane count 4 | Protein classification CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD81 antigen (26 kDa cell surface protein TAPA-1) (Target of the antiproliferative antibody 1) (Tetraspanin-28) (Tspan-28) (CD antigen CD81)
Protein Class (7)
CD markersDisease related genesHuman disease related genesPlasma proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- CD markers
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Transmembrane
13..33; Helical; 64..84; Helical; 90..112; Helical; 202..224; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
TAPA-1TAPA1TSPAN28
Gene Description
CD81 molecule
Chromosome
11
Position
2376177-2397802
Supporting publications (n)
305
EVMP confidence score
0.88
Fluorescence & Localization
Tissue Specificheart muscleCell SpecificCardiomyocytesBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway
Protein Function (5)
- CD markers
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
Cellular Component (9)
Molecular Function (7)
Biological Process (3)
KEGG (4)
Reactome (4)
Canonical Pathways
M13 Pid erbb4 pathway
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence44
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| receptor | receptor | Baccin2019 | Yes | Yes | |||
| tetraspanins | receptor | HPMR | Yes | Yes | |||
| tet3 | receptor | HPMR | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | HPMR | Yes | ||||
| extracellular | extracellular | OmniPath | Yes |
Page 1 of 5Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
236
Mass
25,809
Sequence
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
3D Structural Models
Helix
10..36; 57..80; 81..84; 113..115; 116..136; 141..154; 163..165; 166..171; 172..174; 181..185; 190..199; 202..230
Beta Strand
158..160
3D Structure
Electron microscopy (1); X-ray crystallography (15)
Domain & Motif Annotations
Domain (CC)
Binds cholesterol in a cavity lined by the transmembrane spans.
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Supporting Publications305
| PMID | Title | Related sentences |
|---|---|---|
| 37812687 | Multiplex Quantification of Exosomes via Multiple Types of Nanobeads Labeling Combined with Laser Scanning Detection. | Furthermore, CD147-positive, HER2-positive, and CD81-positive exosomes in 12.5 \xce\xbcL of serum were simultaneously quantified with high discrimination performance using the anti-CD147 antibody, anti-HER2 antibody, or anti-CD81 antibody conjugated for FG beads, Au nanobeads, or Ag nanobeads, respectively. |
| 37893089 | Isolation of Bovine and Human Milk Extracellular Vesicles. | The purified exosomes express the typical exosomal protein markers, CD81 and ALIX. |
| 37948136 | Study on tumour cell-derived hybrid exosomes as dasatinib nanocarriers for pancreatic cancer therapy. | Major protein analysis from western blot techniques reveal the presence of exosome marker proteins CD9 and CD81. |
| 37960298 | Application of Milk Exosomes for Musculoskeletal Health: Talking Points in Recent Outcomes. | Discovered through electron microscopy as floating vesicles, the existence of exosomes in human milk was confirmed owing to a density between 1.10 and 1.18 g/mL in a sucrose gradient corresponding to the known density of exosomes and detection of MHC classes I and II, CD63, CD81, and CD86 on the vesicles. |
| 37968711 | Human umbilical cord mesenchymal stem cell-derived exosomes promote microcirculation in aged diabetic mice by TGF-β1 signaling pathway. | Human umbilical cord mesenchymal stem cell-derived exosomes promote microcirculation in aged diabetic mice by TGF-\xce\xb21 signaling pathway. The mechanism may be associated with exosomes rich in TGF-\xce\xb21, which is likely to promote endothelial cell proliferation and improve permeability through binding to the endothelial CD105/T\xce\xb2R-II receptor complex, while promoting angiogenesis and protecting skeletal muscle cells from apoptosis. Therefore, this study verified the changes of CD105 in the exosome group, and it was used as the mechanism study of this study. Western blot analysis showed that the expression of CD105 protein in lower limb muscle tissue of exosome group was significantly increased compared with that of PBS group. Western blot showed positive expression of specific proteins CD9, CD81 and TSG101 on exosomes.2. |
| 38069981 | Influence of the isolation method on characteristics and functional activity of mesenchymal stromal cell-derived extracellular vesicles. | MSC-EVs isolated from IEX and UF were positive for the exosome markers CD9, CD63 and CD81 and showed a comparable surface marker expression pattern. |
| 38072803 | Metabolic labelling of a subpopulation of small extracellular vesicles using a fluorescent palmitic acid analogue. | The characterization of Bodipy-labelled exosomes reveals their enrichment in tetraspanin markers, particularly CD63 and CD81, and in minor proportion CD9. |
| 38199177 | BeWo exomeres are enriched for bioactive extracellular placenta-specific C19MC miRNAs. | Exomeres were positive for AGO2 but negative for exosome markers (CD63, CD9, CD81, FLOT1, and TSG101). |
| 38247836 | Zika Virus-Infected Monocyte Exosomes Mediate Cell-to-Cell Viral Transmission. | We isolated exosomes from ZIKV-infected monocytes (M\xc3\xb8 exo ZIKV) by differential ultracentrifugation and identified them by nanoparticle tracking analysis; transmission electron microscopy; and CD63, CD81, TSG101, and Alix detection by cytofluorometry. |
| 38400284 | Negative Charge-Carrying Glycans Attached to Exosomes as Novel Liquid Biopsy Marker. | In addition, surface plasmon resonance (SPR) is used to study three different receptors on the exosomal surface (CD63, CD81 and prostate-specific membrane antigen-PMSA), implementing monoclonal antibodies and identifying the type of glycans present on the surface of exosomes using lectins (glycan-recognising proteins). |