Protein detail
SNP25
Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)
Entry name SNP25 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPredicted intracellular proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Synaptosomal-associated protein 25 (SNAP-25) (Super protein) (SUP) (Synaptosomal-associated 25 kDa protein)
Protein Class (5)
Disease related genesFDA approved drug targetsHuman disease related genesPredicted intracellular proteinsTransporters
Protein Function (5)
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Transporters:Transporter channels and pores
- Disease related genes
- FDA approved drug targets:Biotech drugs
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
bA416N4.2dJ1068F16.2RIC-4RIC4SEC9SNAPSNAP-25
Gene Description
Synaptosome associated protein 25
Chromosome
20
Position
10172395-10308258
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificMyonucleiSingle-Nuclei Brain Specificfibroblast
Function & Pathway
Protein Function (5)
- Human disease related genes:Nervous system diseases:Other nervous and sensory system diseases
- Predicted intracellular proteins
- Transporters:Transporter channels and pores
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component (31)
- GO:0001917 photoreceptor inner segment
- GO:0005737 cytoplasm
- GO:0005768 endosome
- GO:0005802 trans-Golgi network
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0005938 cell cortex
- GO:0008021 synaptic vesicle
- GO:0008076 voltage-gated potassium channel complex
Page 1 of 4
Molecular Function (9)
- GO:0005249 voltage-gated potassium channel activity
- GO:0005484 SNAP receptor activity
- GO:0005515 protein binding
- GO:0008289 lipid binding
- GO:0017022 myosin binding
- GO:0017075 syntaxin-1 binding
- GO:0019904 protein domain specific binding
- GO:0044325 transmembrane transporter binding
- GO:0048306 calcium-dependent protein binding
Biological Process (3)
Reactome (22)
- R-hsa-264642 acetylcholine neurotransmitter release cycle
- R-hsa-9824439 bacterial infection pathways
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-212676 dopamine neurotransmitter release cycle
- R-hsa-888590 gaba synthesis release reuptake and degradation
- R-hsa-210500 glutamate neurotransmitter release cycle
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-163685 integration of energy metabolism
- R-hsa-112316 neuronal system
Page 1 of 3
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence35
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SNAP25 | PRKCA | P17252 | T | 138 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:12459461KEA:12459461SIGNOR:12459461ProtMapper:12459461 |
| SNAP25 | PRKCA | P17252 | S | 187 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | KEA:15277518KEA:12459461ProtMapper:12459461ProtMapper:18171919HPRD:12459461SIGNOR:12459461SIGNOR:18171919 |
| SNAP25 | PRKACA | P17612 | T | 138 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSite | HPRD:12459461KEA:12459461SIGNOR:12459461ProtMapper:12459461 |
| SNAP25 | PRKACA | P17612 | T | 29 | phosphorylation | PhosphoSite | |
| SNAP25 | PRKACA | P17612 | S | 187 | phosphorylation | PhosphoSite | |
| SNAP25 | PRKACA | P17612 | S | 28 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (7)
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SYT1 | P21579 | SNP25 | P60880 | Yes | Yes | SIGNORHPRDCui2007HINTBioGRIDWang | BioGRID:12062043HINT:10692432SIGNOR:16679567HINT:26030874BioGRID:10692432HINT:30610939HPRD:10692432HINT:12062043 | |
| SNAPN | O95295 | SNP25 | P60880 | Yes | Yes | Yes | SIGNORHPRDCui2007HINTWang | HINT:22890573SIGNOR:18167355HINT:10195194HPRD:10195194 |
| CAPS2 | Q86UW7 | SNP25 | P60880 | Yes | Yes | SIGNOR | SIGNOR:24363652 | |
| KPCA | P17252 | SNP25 | P60880 | Yes | Yes | Yes | WangPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDCui2007PhosphoSite_KEAKEAKinexus_KEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | KEA:15277518KEA:12459461ProtMapper:12459461ProtMapper:18171919HPRD:12459461HPRD-phos:12459461PhosphoSite:17325194PhosphoSite:22311984SIGNOR:12459461SIGNOR:18171919 |
| CAPS1 | Q9ULU8 | SNP25 | P60880 | Yes | Yes | SIGNOR | SIGNOR:24363652 | |
| KAPCA | P17612 | SNP25 | P60880 | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | KEA:12459461ProtMapper:12459461PhosphoSite:18171919HPRD:12459461HPRD-phos:12459461SIGNOR:12459461 | ||
| NSF | P46459 | SNP25 | P60880 | Yes | Yes | SIGNOR | SIGNOR:16679567 |
Protein Complex Composition (15)
15 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| SNARE complex (HGSSNAP25STX13) | HGSSNAP25STX12 | O14964P60880Q86Y82 | 1:1:1 | CompleatCORUM | CORUM:706Compleat:HC1780 | 14769786 |
| SNARE complex (SNAP25VAMP3VAMP2NAPBSTX13) | NAPBSNAP25STX12VAMP2VAMP3 | P60880P63027Q15836Q86Y82Q9H115 | 1:1:1:1:1 | CompleatCORUM | Compleat:HC3498CORUM:1874 | 9817754 |
| SNARE complex (VAMP2SNAP25STX13) | SNAP25STX12VAMP2 | P60880P63027Q86Y82 | 1:1:1 | CompleatCORUM | CORUM:707Compleat:HC1840 | 14769786 |
| SNARE complex (VAMP2SNAP25STX1aCPLX1) | CPLX1SNAP25STX1AVAMP2 | O14810P60880P63027Q16623 | 1:1:1:1 | CORUMCompleatCFinder | Compleat:HC1741CORUM:793 | 7553862 |
| SNARE complex (VAMP2SNAP25STX1aCPLX1CPLX3) | CPLX1CPLX3SNAP25STX1AVAMP2 | O14810P60880P63027Q16623Q8WVH0 | 1:1:1:1:1 | CompleatCORUM | CORUM:1137Compleat:HC1771 | 15911881 |
| SNARE complex (VAMP2SNAP25STX1aCPLX2) | CPLX2SNAP25STX1AVAMP2 | P60880P63027Q16623Q6PUV4 | 1:1:1:1 | CompleatCORUM | Compleat:HC558CORUM:794 | 7553862 |
| SNARE complex (VAMP2SNAP25STX1aCPLX3CPLX4) | CPLX3CPLX4SNAP25STX1AVAMP2 | P60880P63027Q16623Q7Z7G2Q8WVH0 | 1:1:1:1:1 | CompleatCORUM | Compleat:HC154CORUM:1138 | 15911881 |
| SNARE complex (VAMP2SNAP25STX1aSTX3CPLX1CPLX3CPLX4) | CPLX1CPLX3CPLX4SNAP25STX1ASTX3VAMP2 | O14810P60880P63027Q13277Q16623Q7Z7G2Q8WVH0 | 1:1:1:1:1:1:1 | CompleatCORUM | Compleat:HC2346CORUM:1139 | 15911881 |
| SNARE complex STX1A-SNAP25-VAMP1 | SNAP25STX1AVAMP1 | P23763P60880Q16623 | 1:1:1 | ComplexPortal | 2913915926635000147552923784858920798282 | |
| SNARE complex STX1B-SNAP25-VAMP1 | SNAP25STX1BVAMP1 | P23763P60880P61266 | 1:1:1 | ComplexPortal | 2913915926635000147552923784858920798282 |
Page 1 of 2Next
Sequence, Structure & Domains
Sequences
Length
206
Mass
23,315
Sequence
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG
Alternative Products
Event=Alternative splicing; Named isoforms=2; Comment=Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which code for positions 56 to 94 and differ only in 9 positions out of 39.; Name=1; Synonyms=SNAP-25b; IsoId=P60880-1, P13795-1; Sequence=Displayed; Name=2; Synonyms=SNAP-25a; IsoId=P60880-2, P13795-2; Sequence=VSP_006186
Alternative Sequence
58..89; ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV -> DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI (in isoform 2)
3D Structural Models
Helix
8..80; 148..167
Beta Strand
191..193
3D Structure
NMR spectroscopy (1); X-ray crystallography (13)
Domain & Motif Annotations
Compositional Bias
1..20; Basic and acidic residues
Domain (FT)
19..81; t-SNARE coiled-coil homology 1; 140..202; t-SNARE coiled-coil homology 2
Region
1..75; Interaction with CENPF; 1..23; Disordered; 111..120; Interaction with ZDHHC17
Protein Families
SNAP-25 family
Sequence Similarities
Belongs to the SNAP-25 family.
Clinical Relevance
Disease Involvement (4)
Congenital myasthenic syndromeDisease variantFDA approved drug targetsIntellectual disability
Related Diseases (3)
Biomarker
Approved
Drug Targets
FDA approved drug targets
Drugs (7)
Interaction Protein (3)
ENSG00000106089ENSG00000135604ENSG00000205726
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38037300 | Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles. | No related sentences available |